SimulationCraft has not been built with PTR data.  The 'ptr=' option is ignored.
close

SimulationCraft 725-01

for World of Warcraft 7.2.5 Live (wow build level 24287)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-06-14 Balance T20 4pc now last for 20 seconds.
(effect#1) duration 0.00 0.00 Verification Failure (15.00)
2017-06-14 Feral T20 4pc now only increase duration by 4 seconds
Item - Druid T20 Feral 4P Bonus (effect#2) base_value 4000.00 4000.00 Verification Failure (8000.00)
2017-06-14 Feral T20 4pc reduced to 10% damage increase
Item - Druid T20 Feral 4P Bonus (effect#1) base_value 10.00 10.00 Verification Failure (15.00)
2017-06-14 Feral T20 2pc reduced to 1 energy per tick from 2
Energetic Rip (effect#1) base_value 1.00 1.00 Verification Failure (2.00)

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Current simulator-wide DBC data overrides

Spell / Effect Field Override Value DBC Value
Smoldering Heart (effect#2) base_value 10.00 20.00
Lava Burst (effect#1) sp_coefficient 2.83 2.75
Lava Burst Overload (effect#1) sp_coefficient 2.83 2.75
Chain Lightning (effect#1) sp_coefficient 1.65 1.60
Chain Lightning Overload (effect#1) sp_coefficient 1.65 1.60
Lightning Bolt (effect#1) sp_coefficient 1.80 1.75
Lightning Bolt Overload (effect#1) sp_coefficient 1.80 1.75
Elemental Blast (effect#1) sp_coefficient 7.00 6.80
Elemental Blast Overload (effect#1) sp_coefficient 7.00 6.80
Icefury (effect#1) sp_coefficient 9.27 9.00
Icefury Overload (effect#1) sp_coefficient 9.27 9.00
Earth Shock (effect#1) sp_coefficient 11.85 11.50
Flame Shock (effect#1) sp_coefficient 0.82 0.80
Flame Shock (effect#2) sp_coefficient 0.41 0.40
Frost Shock (effect#1) sp_coefficient 0.82 0.80
Volcanic Inferno (effect#1) sp_coefficient 0.62 0.60
Fire Blast (effect#1) sp_coefficient 2.78 2.70
Lightning Blast (effect#1) sp_coefficient 2.06 2.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

3ilevel : 1156637 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1156636.7 1156636.7 924.8 / 0.080% 164090.4 / 14.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 52.7 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
3ilevel 1156637
Earth Shock 106281 9.2% 15.5 18.64sec 2057830 2055359 Direct 15.5 1390789 4066121 2057945 24.9%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.49 15.49 0.00 0.00 1.0013 0.0000 31878622.36 31878622.36 0.00 2055359.28 2055359.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.63 75.07% 1390789.04 1163244 1634572 1391276.65 1260793 1519069 16173656 16173656 0.00
crit 3.86 24.93% 4066121.07 3401324 4779488 4008976.00 0 4779488 15704967 15704967 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 64816 (99106) 5.6% (8.6%) 22.0 13.81sec 1350584 993991 Direct 22.0 600735 1758127 885041 24.6%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 21.96 0.00 0.00 1.3588 0.0000 19434132.60 19434132.60 0.00 993990.77 993990.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.56 75.43% 600735.28 534196 666572 600919.69 565575 635607 9949732 9949732 0.00
crit 5.39 24.57% 1758127.43 1561990 1949057 1753376.63 0 1949057 9484401 9484401 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 34290 3.0% 13.9 21.31sec 739990 0 Direct 13.9 504754 1476302 741824 24.4%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.90 13.87 0.00 0.00 0.0000 0.0000 10288179.52 10288179.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.49 75.60% 504753.60 448725 559921 504944.99 466253 551437 5292906 5292906 0.00
crit 3.38 24.40% 1476302.08 1312071 1637208 1436588.71 0 1637208 4995273 4995273 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 128386 11.1% 11.2 27.76sec 3426664 3494962 Direct 11.2 89103 264340 222529 76.1%  
Periodic 226.4 49099 197841 158672 73.7% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 226.43 226.43 0.9805 1.3169 38423615.36 38423615.36 0.00 124274.67 3494962.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.68 23.86% 89102.68 79768 99535 87953.85 0 97621 238394 238394 0.00
crit 8.54 76.14% 264339.60 233243 291041 264399.50 248603 281238 2256841 2256841 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.6 26.33% 49099.23 39 54745 49092.12 44967 51878 2927443 2927443 0.00
crit 166.8 73.67% 197841.12 140 224105 197947.57 186577 208297 33000937 33000937 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 127830 11.1% 38.2 7.56sec 1002330 1018695 Direct 38.2 674306 1975778 1002315 25.2%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.20 38.20 0.00 0.00 0.9839 0.0000 38293770.07 38293770.07 0.00 1018695.17 1018695.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.58 74.80% 674306.29 604307 754054 674632.90 643010 714048 19268736 19268736 0.00
crit 9.63 25.20% 1975778.06 1766992 2204854 1975317.44 1766992 2204854 19025034 19025034 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 36796 (56619) 3.2% (4.9%) 9.7 32.22sec 1755950 1339665 Direct 9.6 764644 2239886 1144087 25.7%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.66 9.63 0.00 0.00 1.3108 0.0000 11020724.85 11020724.85 0.00 1339664.70 1339664.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.16 74.28% 764644.16 679832 848297 764897.39 699361 848297 5471435 5471435 0.00
crit 2.48 25.72% 2239886.47 1987830 2480421 2102867.15 0 2480421 5549290 5549290 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 19823 1.7% 6.2 47.11sec 959119 0 Direct 6.2 642470 1881093 961765 25.8%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.19 6.17 0.00 0.00 0.0000 0.0000 5934071.65 5934071.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.58 74.22% 642470.27 571059 712570 641071.19 0 712570 2942232 2942232 0.00
crit 1.59 25.78% 1881092.66 1669777 2083554 1544658.60 0 2083554 2991839 2991839 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Insidious Corruption 14596 1.3% 5.1 60.45sec 857216 0 Periodic 48.0 73697 150111 91359 23.1% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.11 0.00 47.98 47.98 0.0000 1.2495 4383266.76 4383266.76 0.00 73114.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 76.89% 73697.39 109 76542 73685.06 68874 76542 2718940 2718940 0.00
crit 11.1 23.11% 150110.68 222 156146 150060.84 0 156146 1664327 1664327 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 161086 (252101) 13.9% (21.8%) 58.1 5.12sec 1301444 1078891 Direct 57.9 0 833504 833504 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.09 57.94 0.00 0.00 1.2063 0.0000 48297364.66 48297364.66 0.00 1078890.77 1078890.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 57.94 100.00% 833503.96 751903 938226 833643.40 805640 869324 48297365 48297365 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 82434 7.1% 37.0 7.97sec 667400 0 Direct 36.9 0 669488 669488 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.05 36.93 0.00 0.00 0.0000 0.0000 24725584.20 24725584.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 36.93 100.00% 669488.00 603957 753619 669599.47 643429 700575 24725584 24725584 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8581 0.7% 43.1 6.29sec 59657 0 Direct 43.1 47459 96815 59658 24.7%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.14 43.14 0.00 0.00 0.0000 0.0000 2573848.78 2573848.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.48 75.29% 47459.32 45328 51418 47469.82 45328 50759 1541595 1541595 0.00
crit 10.66 24.71% 96815.22 92469 104893 96818.25 0 104893 1032254 1032254 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 104323 (192042) 9.0% (16.6%) 89.1 3.28sec 645922 512094 Direct 89.1 239943 691528 350825 24.6%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.10 89.10 0.00 0.00 1.2613 0.0000 31260471.38 31260471.38 0.00 512093.64 512093.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.23 75.45% 239943.28 158100 591833 240114.01 198456 279334 16130404 16130404 0.00
crit 21.88 24.55% 691527.97 462284 1730518 691543.33 495280 1161477 15130068 15130068 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 87718 7.6% 87.9 4.08sec 299011 0 Direct 87.9 204548 591111 299013 24.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.94 87.94 0.00 0.00 0.0000 0.0000 26293732.36 26293732.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.45 75.56% 204547.74 132804 497139 204530.67 153046 265451 13591449 13591449 0.00
crit 21.49 24.44% 591110.64 388319 1453635 591097.91 414425 900390 12702283 12702283 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45540 (66592) 3.9% (5.7%) 3.0 120.41sec 6641420 0 Direct 94.1 116064 236771 144021 23.2%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 94.14 94.14 0.00 0.0000 0.6136 13557688.81 13557688.81 0.00 343220.89 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.33 76.84% 116064.33 116064 116064 116064.33 116064 116064 8395484 8395484 0.00
crit 21.80 23.16% 236771.23 236771 236771 236771.23 236771 236771 5162205 5162205 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21052 1.8% 37.4 7.01sec 167378 0 Direct 37.3 135409 276235 168027 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.45 37.30 0.00 0.00 0.0000 0.0000 6267779.50 6267779.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.66 76.84% 135409.19 135409 135409 135409.19 135409 135409 3881318 3881318 0.00
crit 8.64 23.16% 276234.76 276235 276235 276200.23 0 276235 2386461 2386461 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 136037 / 87285
Fire Blast 136037 7.5% 97.0 3.00sec 268837 138485 Direct 97.0 215550 431139 268837 24.7%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.00 97.00 0.00 0.00 1.9413 0.0000 26075870.37 26075870.37 0.00 138484.87 138484.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.02 75.28% 215550.29 203949 231353 215608.23 209110 222753 15739731 15739731 0.00
crit 23.97 24.72% 431138.72 407899 462707 431250.04 416372 451229 10336140 10336140 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 181465 / 25799
Lightning Blast 181465 2.2% 39.5 7.14sec 195277 198641 Direct 39.5 158323 316653 195276 23.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.55 39.55 0.00 0.00 0.9831 0.0000 7722954.35 7722954.35 0.00 198640.77 198640.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.32 76.66% 158322.79 151074 171373 158349.67 152538 168653 4800011 4800011 0.00
crit 9.23 23.34% 316653.14 302147 342746 316739.98 302147 342746 2922943 2922943 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
3ilevel
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 105.66sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.46 0.00 0.00 0.00 1.0424 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.65sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8407 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 112.95sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5187 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.0sec 32.20% 32.20% 3.1(3.1) 7.9

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.5 1.4 27.3sec 23.8sec 34.65% 34.65% 1.4(1.4) 10.2

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.5 1.4 27.3sec 23.7sec 34.71% 34.71% 1.4(1.4) 10.2

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 28.0sec 23.5sec 33.75% 33.75% 1.8(1.8) 9.9

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.3 27.2 4.2sec 3.0sec 60.53% 63.54% 27.2(33.8) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:26.64%
  • elemental_focus_2:33.89%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.17% 19.17% 0.0(0.0) 4.7

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.2sec 32.2sec 21.22% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.63%
  • icefury_2:6.13%
  • icefury_3:5.17%
  • icefury_4:3.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 21.4 1.3 13.5sec 12.7sec 10.25% 38.52% 1.3(1.3) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.25%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.87% 29.87% 4.2(4.2) 12.6

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 94.4sec 0.0sec 39.91% 39.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.2 1.4 37.8sec 30.9sec 22.53% 25.33% 1.4(2.9) 0.1

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.40%
  • power_of_the_maelstrom_2:6.56%
  • power_of_the_maelstrom_3:9.57%

Trigger Attempt Success

  • trigger_pct:14.95%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 13.03% 9.63% 0.0(0.0) 0.3

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.58%
  • stormkeeper_2:3.86%
  • stormkeeper_3:4.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 112.9sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 22.7 12.7sec
Lava Surge: Wasted 1.3 80.7sec
Lava Surge: During Lava Burst 3.7 58.1sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7130.0014.7122.6090.0008.696
Fire Elemental0.5150.0011.6000.5930.0003.338
Lava Burst0.9300.0018.8247.5120.00026.050
Elemental Blast0.5550.0015.4339.3222.94317.834
Icefury1.0610.0017.8827.7590.67622.655

Resources

Resource Usage Type Count Total Average RPE APR
3ilevel
earth_shock Maelstrom 122.1 14664.0 120.1 946.6 2173.9
flame_shock Maelstrom 88.4 1577.1 17.8 140.6 24363.8
frost_shock Maelstrom 301.1 6022.7 20.0 157.6 6358.2
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 457.83 5435.52 (23.95%) 11.87 58.39 1.06%
Lava Burst Overload Maelstrom 291.99 2533.22 (11.16%) 8.68 94.71 3.60%
Lightning Bolt Maelstrom 702.31 5602.76 (24.69%) 7.98 15.68 0.28%
Lightning Bolt Overload Maelstrom 693.11 4107.37 (18.10%) 5.93 51.28 1.23%
Icefury Maelstrom 76.11 1815.58 (8.00%) 23.86 10.99 0.60%
Icefury Overload Maelstrom 48.76 867.44 (3.82%) 17.79 10.32 1.18%
Resonance Totem Maelstrom 2352.46 2329.38 (10.27%) 0.99 23.08 0.98%
Resource RPS-Gain RPS-Loss
Maelstrom 9.60 9.42
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 55.37 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data 3ilevel Fight Length
Count 8000
Mean 300.00
Minimum 239.99
Maximum 359.99
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 36.0247
5th Percentile 245.61
95th Percentile 354.41
( 95th Percentile - 5th Percentile ) 108.80
Mean Distribution
Standard Deviation 0.4028
95.00% Confidence Intervall ( 299.21 - 300.79 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 554
0.1% Error 55394
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1108
DPS
Sample Data 3ilevel Damage Per Second
Count 8000
Mean 1156636.69
Minimum 1016174.32
Maximum 1333897.70
Spread ( max - min ) 317723.39
Range [ ( max - min ) / 2 * 100% ] 13.73%
Standard Deviation 42204.4199
5th Percentile 1089145.91
95th Percentile 1227722.75
( 95th Percentile - 5th Percentile ) 138576.84
Mean Distribution
Standard Deviation 471.8598
95.00% Confidence Intervall ( 1155711.86 - 1157561.52 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5115
0.1 Scale Factor Error with Delta=300 15205460
0.05 Scale Factor Error with Delta=300 60821837
0.01 Scale Factor Error with Delta=300 1520545919
Priority Target DPS
Sample Data 3ilevel Priority Target Damage Per Second
Count 8000
Mean 1156636.69
Minimum 1016174.32
Maximum 1333897.70
Spread ( max - min ) 317723.39
Range [ ( max - min ) / 2 * 100% ] 13.73%
Standard Deviation 42204.4199
5th Percentile 1089145.91
95th Percentile 1227722.75
( 95th Percentile - 5th Percentile ) 138576.84
Mean Distribution
Standard Deviation 471.8598
95.00% Confidence Intervall ( 1155711.86 - 1157561.52 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5115
0.1 Scale Factor Error with Delta=300 15205460
0.05 Scale Factor Error with Delta=300 60821837
0.01 Scale Factor Error with Delta=300 1520545919
DPS(e)
Sample Data 3ilevel Damage Per Second (Effective)
Count 8000
Mean 1156636.69
Minimum 1016174.32
Maximum 1333897.70
Spread ( max - min ) 317723.39
Range [ ( max - min ) / 2 * 100% ] 13.73%
Damage
Sample Data 3ilevel Damage
Count 8000
Mean 312632852.86
Minimum 222654043.72
Maximum 399563083.17
Spread ( max - min ) 176909039.45
Range [ ( max - min ) / 2 * 100% ] 28.29%
DTPS
Sample Data 3ilevel Damage Taken Per Second
Count 8000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data 3ilevel Healing Per Second
Count 8000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data 3ilevel Healing Per Second (Effective)
Count 8000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data 3ilevel Heal
Count 8000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data 3ilevel Healing Taken Per Second
Count 8000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data 3ilevel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data 3ilevelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data 3ilevel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.16 totem_mastery,if=buff.resonance_totem.remains<2
9 3.46 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.10 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.48 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.51 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.10 elemental_blast
Keep your EB always on Cooldown.
I 11.72 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.41 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.70 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.71 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 58.25 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.69 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.74 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 3.77 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.03 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 17.94 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 66.80 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNSNSOSSMRHRRSPMASSSSSSSHIMSSKMGMGNNRRHMPFRMSSMRRHIMJLMMKLGFLHMGMGMGRMAISHSSMSOSSS97HMIKMNNSMNNQHSSMMRRPARJMHOSSSSMMIKNNHMMANNRRRMSOHSSMISSMSMHKNNNNMSSSSHMIJMOSSMLRRHPMSKM9ANNMNHNRORMRSSSHIMMQRRRKGGHMGMGRIAMOMJLHLMSMPRRRSMHAPKMNNMNRRNRHMFSSSMSISHMMSMKGMGM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.058 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.058 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.874 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.938 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.005 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:04.768 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:05.785 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:06.548 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:07.313 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:08.092 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:08.870 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:09.649 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.429 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.205 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.984 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.020 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:14.037 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:15.102 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:16.167 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.232 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:18.297 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:19.361 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.178 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.266 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.266 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.352 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:23.438 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:24.524 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:25.609 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.696 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:27.781 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.867 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.954 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.771 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.859 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.945 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.031 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:35.118 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, potion_of_prolonged_power
0:35.935 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, potion_of_prolonged_power
0:36.751 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
0:37.838 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:38.656 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:39.471 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:40.288 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:41.375 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:42.787 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:44.199 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:45.612 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:46.650 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:47.689 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.074 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:50.112 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:51.497 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:52.880 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.292 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.704 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.115 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.526 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.536 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.545 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.554 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.563 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.574 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.919 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.460 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:07.471 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom lava_surge, elemental_blast_haste, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:08.483 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_haste, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:09.493 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:10.551 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:11.963 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:13.021 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:14.080 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:15.492 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:16.552 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:17.611 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:18.670 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.082 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.495 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.495 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.555 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.968 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.353 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.737 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:28.122 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:29.506 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:30.889 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.951 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.362 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.774 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:36.187 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:37.246 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:37.246 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:38.760 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:39.819 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:40.830 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:42.176 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, potion_of_prolonged_power
1:43.523 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, potion_of_prolonged_power
1:44.533 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
1:45.543 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
1:46.890 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
1:48.236 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
1:49.247 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:50.306 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.062 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:52.474 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:53.885 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.232 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.242 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.588 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:58.910 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:00.228 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:01.219 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:01.219 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:02.539 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:03.531 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.942 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.352 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.412 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.422 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.432 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:10.443 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.790 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:12.801 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.145 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:15.156 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:16.502 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
2:17.512 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
2:18.570 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
2:19.981 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
2:20.990 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
2:22.335 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:22.335 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:23.347 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:24.359 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.706 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.053 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.401 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:29.747 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:31.095 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:32.155 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:33.567 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:34.978 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
2:36.390 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
2:37.801 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:38.840 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:40.223 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:41.606 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:42.644 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:44.056 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:45.468 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:46.973 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.384 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:49.443 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:50.504 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:51.566 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:52.626 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.038 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:55.423 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.807 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.190 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.574 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.987 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.307 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:03.298 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:04.518 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:05.510 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:06.500 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:07.510 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:08.505 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:09.826 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:10.817 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:12.137 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:13.520 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.931 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.992 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.404 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.817 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.230 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:21.290 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:22.350 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:22.350 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:23.409 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:24.448 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:25.830 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:26.868 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:28.309 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:29.349 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.734 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.793 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.205 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.617 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:36.029 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:37.441 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.852 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:40.263 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:41.718 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:42.779 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:43.838 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:45.249 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:46.005 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:47.418 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:48.828 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:50.240 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:51.650 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:52.710 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:53.769 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:55.179 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:56.191 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:57.202 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:58.549 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
3:59.559 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.906 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.916 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.916 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.928 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.938 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.285 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.344 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.404 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.814 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.852 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:10.891 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:11.930 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.314 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:14.353 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.764 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.174 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.586 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.998 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.410 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.822 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.822 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.833 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.180 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:26.171 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:27.160 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
4:28.154 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
4:29.473 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
4:30.465 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:31.811 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:33.158 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:34.218 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:35.630 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:37.040 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:38.452 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:39.511 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:40.924 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:42.336 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:43.748 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:45.159 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:46.570 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:47.629 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.040 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.452 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.462 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.808 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.155 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.167 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.522 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:57.533 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:58.543 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:59.552 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84818 84818 44295
Intellect 60171 57940 47856 (23864)
Spirit 0 0 0
Health 5089080 5089080 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60171 57940 0
Crit 20.33% 20.33% 6133
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.79% 58.79% 7253
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 957, weapon: { 4465 - 8293, 2.6 }, stats: { +1582 Int, +2373 Sta, +445 Crit, +428 Mastery, +20134 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 957, stats: { +2076 Int, +3115 Sta, +585 Crit, +561 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="3ilevel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:7:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,ilevel=957
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.88
# gear_stamina=44295
# gear_intellect=47856
# gear_crit_rating=6133
# gear_haste_rating=11779
# gear_mastery_rating=7253
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

baseline : 1103915 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1103915.0 1103915.0 882.7 / 0.080% 154236.9 / 14.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 52.7 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
baseline 1103915
Earth Shock 101665 9.2% 15.5 18.63sec 1970636 1967910 Direct 15.5 1366407 3782717 1970485 25.0%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.47 15.47 0.00 0.00 1.0014 0.0000 30488823.08 30488823.08 0.00 1967909.58 1967909.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.60 74.99% 1366406.90 1149885 1587850 1366852.22 1259507 1472130 15854000 15854000 0.00
crit 3.87 25.01% 3782717.40 3182882 4395169 3737614.13 0 4395169 14634823 14634823 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 61992 (94823) 5.6% (8.6%) 22.0 13.81sec 1292313 951130 Direct 22.0 590331 1635255 846800 24.5%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 21.95 0.00 0.00 1.3587 0.0000 18592061.98 18592061.98 0.00 951129.95 951129.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.57 75.45% 590330.97 528062 647519 590480.09 563415 618893 9779188 9779188 0.00
crit 5.39 24.55% 1635255.26 1461674 1792333 1631160.48 0 1792333 8812874 8812874 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 32831 3.0% 13.9 21.24sec 708421 0 Direct 13.9 495998 1373545 710034 24.4%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.90 13.87 0.00 0.00 0.0000 0.0000 9846723.53 9846723.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.49 75.61% 495997.68 443572 543916 496150.27 461654 529919 5200831 5200831 0.00
crit 3.38 24.39% 1373544.86 1227806 1505559 1336219.43 0 1505559 4645892 4645892 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 120045 10.9% 11.2 27.78sec 3203421 3266768 Direct 11.2 87536 246067 208190 76.1%  
Periodic 226.4 48243 184093 148367 73.7% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 226.41 226.41 0.9807 1.3170 35927913.77 35927913.77 0.00 116198.99 3266767.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.68 23.89% 87535.78 78852 96690 86349.78 0 96690 234530 234530 0.00
crit 8.54 76.11% 246066.71 218264 267638 246118.41 230997 260022 2100493 2100493 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.5 26.30% 48243.18 34 53181 48238.60 44635 50286 2872189 2872189 0.00
crit 166.9 73.70% 184092.52 131 206085 184187.72 174098 192140 30720702 30720702 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 122571 11.1% 38.2 7.56sec 960663 976338 Direct 38.2 662726 1836913 960668 25.4%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.23 38.23 0.00 0.00 0.9840 0.0000 36724968.80 36724968.80 0.00 976338.40 976338.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.53 74.63% 662725.62 562802 732501 663030.92 635369 703303 18906989 18906989 0.00
crit 9.70 25.37% 1836912.56 1653511 2027563 1836341.48 1653511 1975388 17817979 17817979 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35271 (54093) 3.2% (4.9%) 9.7 32.21sec 1675353 1277911 Direct 9.6 751467 2083090 1094795 25.8%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.67 9.65 0.00 0.00 1.3110 0.0000 10563240.02 10563240.02 0.00 1277910.91 1277910.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.16 74.22% 751467.50 672025 824050 751743.39 672025 813175 5381760 5381760 0.00
crit 2.49 25.78% 2083089.98 1860166 2280970 1968746.98 0 2280970 5181480 5181480 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18822 1.7% 6.2 47.15sec 915768 0 Direct 6.1 631241 1749814 917800 25.6%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.16 6.14 0.00 0.00 0.0000 0.0000 5639392.42 5639392.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.57 74.38% 631240.57 564501 692202 629519.34 0 692202 2885216 2885216 0.00
crit 1.57 25.62% 1749814.40 1562539 1916015 1426011.45 0 1916015 2754176 2754176 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Insidious Corruption 14600 1.3% 5.1 60.44sec 855634 0 Periodic 48.0 73696 150174 91391 23.1% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 0.00 47.98 47.98 0.0000 1.2496 4384610.28 4384610.28 0.00 73140.23 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 76.86% 73696.16 109 76542 73686.24 69153 76542 2717472 2717472 0.00
crit 11.1 23.14% 150174.40 222 156146 150136.35 108812 156146 1667139 1667139 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 149288 (234427) 13.5% (21.3%) 58.0 5.10sec 1211133 1003748 Direct 57.9 0 773215 773215 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.03 57.89 0.00 0.00 1.2066 0.0000 44763148.04 44763148.04 0.00 1003748.35 1003748.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 57.89 100.00% 773215.49 701650 860376 773325.67 748525 797544 44763148 44763148 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 76737 7.0% 36.9 7.95sec 622714 0 Direct 36.8 0 624677 624677 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.95 36.83 0.00 0.00 0.0000 0.0000 23006475.69 23006475.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 36.83 100.00% 624677.28 566884 695123 624761.79 600259 649393 23006476 23006476 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8402 0.8% 43.0 6.23sec 58577 0 Direct 43.0 46631 95138 58577 24.6%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.98 42.98 0.00 0.00 0.0000 0.0000 2517854.48 2517854.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.40 75.37% 46631.40 44808 49948 46643.11 45005 48812 1510785 1510785 0.00
crit 10.59 24.63% 95138.01 91408 101895 95111.74 0 101895 1007069 1007069 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 99770 (183792) 9.0% (16.7%) 89.1 3.28sec 618049 489945 Direct 89.1 235743 643539 335423 24.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.11 89.11 0.00 0.00 1.2615 0.0000 29891312.73 29891312.73 0.00 489945.04 489945.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.33 75.56% 235743.12 156284 574916 235938.09 199548 272490 15873564 15873564 0.00
crit 21.78 24.44% 643538.77 432595 1591368 643575.84 463492 935211 14017748 14017748 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 84022 7.6% 87.9 4.09sec 286615 0 Direct 87.9 201095 549301 286602 24.6%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.87 87.87 0.00 0.00 0.0000 0.0000 25185858.47 25185858.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.29 75.44% 201094.82 131279 482929 201116.94 155898 257023 13331196 13331196 0.00
crit 21.58 24.56% 549300.95 363380 1336749 549145.78 390283 883956 11854662 11854662 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45627 (66747) 4.1% (6.0%) 3.0 120.39sec 6658486 0 Direct 94.3 116064 236771 144041 23.2%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 94.29 94.29 0.00 0.0000 0.6138 13580979.80 13580979.80 0.00 343318.76 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.43 76.82% 116064.33 116064 116064 116064.33 116064 116064 8407105 8407105 0.00
crit 21.85 23.18% 236771.23 236771 236771 236771.23 236771 236771 5173875 5173875 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21120 1.9% 37.6 7.00sec 167354 0 Direct 37.4 135409 276235 168012 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.57 37.43 0.00 0.00 0.0000 0.0000 6287906.82 6287906.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.76 76.85% 135409.19 135409 135409 135409.19 135409 135409 3894675 3894675 0.00
crit 8.66 23.15% 276234.76 276235 276235 276234.76 276235 276235 2393232 2393232 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 133665 / 85800
Fire Blast 133665 7.8% 97.0 3.00sec 264136 136060 Direct 97.0 211860 423628 264136 24.7%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.03 97.03 0.00 0.00 1.9413 0.0000 25629240.08 25629240.08 0.00 136060.14 136060.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.08 75.31% 211859.55 201607 224741 211914.07 207466 218485 15482377 15482377 0.00
crit 23.95 24.69% 423628.28 403214 449481 423715.15 411106 442126 10146863 10146863 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 178090 / 25352
Lightning Blast 178090 2.3% 39.6 7.14sec 191675 194893 Direct 39.6 155533 311148 191673 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.59 39.59 0.00 0.00 0.9835 0.0000 7587964.85 7587964.85 0.00 194893.02 194893.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.39 76.78% 155533.21 149339 166474 155565.85 151033 162774 4727204 4727204 0.00
crit 9.19 23.22% 311148.07 298677 332949 311228.43 298677 332949 2860761 2860761 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
baseline
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 105.49sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.47 0.00 0.00 0.00 1.0425 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.66sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8412 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 112.99sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5185 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 24.9sec 32.29% 32.29% 3.1(3.1) 8.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.3sec 23.7sec 34.80% 34.80% 1.4(1.4) 10.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.5 1.4 27.5sec 23.8sec 34.48% 34.48% 1.4(1.4) 10.1

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 28.0sec 23.5sec 33.73% 33.73% 1.8(1.8) 9.9

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.3 27.2 4.2sec 3.0sec 60.48% 63.52% 27.2(33.8) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:26.58%
  • elemental_focus_2:33.90%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.11% 19.11% 0.0(0.0) 4.7

Buff details

  • buff initial source:baseline
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.2sec 32.2sec 21.30% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.66%
  • icefury_2:6.12%
  • icefury_3:5.18%
  • icefury_4:3.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 21.3 1.3 13.5sec 12.7sec 10.25% 38.44% 1.3(1.3) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.25%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 13.0 4.2 23.0sec 17.1sec 29.97% 29.97% 4.2(4.2) 12.7

Buff details

  • buff initial source:baseline
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 94.3sec 0.0sec 39.91% 39.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.2 1.4 37.8sec 30.9sec 22.54% 25.23% 1.4(3.0) 0.1

Buff details

  • buff initial source:baseline
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.43%
  • power_of_the_maelstrom_2:6.52%
  • power_of_the_maelstrom_3:9.58%

Trigger Attempt Success

  • trigger_pct:14.96%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 13.06% 9.64% 0.0(0.0) 0.3

Buff details

  • buff initial source:baseline
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.54%
  • stormkeeper_2:3.89%
  • stormkeeper_3:4.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 112.9sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 22.6 12.7sec
Lava Surge: Wasted 1.3 78.4sec
Lava Surge: During Lava Burst 3.7 58.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7140.0015.5802.6050.0009.265
Fire Elemental0.5020.0011.5270.5790.0003.450
Lava Burst0.9370.0018.7357.5340.00029.065
Elemental Blast0.5540.0014.4239.2851.79518.437
Icefury1.0610.0018.7477.7630.43023.856

Resources

Resource Usage Type Count Total Average RPE APR
baseline
earth_shock Maelstrom 121.7 14614.8 120.1 944.6 2086.2
flame_shock Maelstrom 88.2 1574.3 17.8 140.4 22821.3
frost_shock Maelstrom 300.7 6014.2 20.0 157.3 6106.4
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 456.49 5418.84 (23.95%) 11.87 59.03 1.08%
Lava Burst Overload Maelstrom 290.59 2521.12 (11.14%) 8.68 94.22 3.60%
Lightning Bolt Maelstrom 700.99 5593.08 (24.72%) 7.98 14.84 0.26%
Lightning Bolt Overload Maelstrom 691.20 4095.52 (18.10%) 5.93 51.68 1.25%
Icefury Maelstrom 76.08 1815.56 (8.02%) 23.86 10.28 0.56%
Icefury Overload Maelstrom 48.44 861.13 (3.81%) 17.78 10.80 1.24%
Resonance Totem Maelstrom 2347.77 2324.66 (10.27%) 0.99 23.11 0.98%
Resource RPS-Gain RPS-Loss
Maelstrom 9.59 9.41
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.22 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Shaman_Elemental_T20M Fight Length
Count 7685
Mean 300.00
Minimum 239.97
Maximum 360.04
Spread ( max - min ) 120.07
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 35.9002
5th Percentile 245.84
95th Percentile 354.16
( 95th Percentile - 5th Percentile ) 108.32
Mean Distribution
Standard Deviation 0.4095
95.00% Confidence Intervall ( 299.20 - 300.81 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 551
0.1% Error 55009
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1101
DPS
Sample Data Shaman_Elemental_T20M Damage Per Second
Count 7685
Mean 1103915.04
Minimum 968771.60
Maximum 1264740.50
Spread ( max - min ) 295968.90
Range [ ( max - min ) / 2 * 100% ] 13.41%
Standard Deviation 39481.6815
5th Percentile 1041176.08
95th Percentile 1171830.03
( 95th Percentile - 5th Percentile ) 130653.95
Mean Distribution
Standard Deviation 450.3744
95.00% Confidence Intervall ( 1103032.32 - 1104797.75 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4914
0.1 Scale Factor Error with Delta=300 13306841
0.05 Scale Factor Error with Delta=300 53227362
0.01 Scale Factor Error with Delta=300 1330684049
Priority Target DPS
Sample Data Shaman_Elemental_T20M Priority Target Damage Per Second
Count 7685
Mean 1103915.04
Minimum 968771.60
Maximum 1264740.50
Spread ( max - min ) 295968.90
Range [ ( max - min ) / 2 * 100% ] 13.41%
Standard Deviation 39481.6815
5th Percentile 1041176.08
95th Percentile 1171830.03
( 95th Percentile - 5th Percentile ) 130653.95
Mean Distribution
Standard Deviation 450.3744
95.00% Confidence Intervall ( 1103032.32 - 1104797.75 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4914
0.1 Scale Factor Error with Delta=300 13306841
0.05 Scale Factor Error with Delta=300 53227362
0.01 Scale Factor Error with Delta=300 1330684049
DPS(e)
Sample Data Shaman_Elemental_T20M Damage Per Second (Effective)
Count 7685
Mean 1103915.04
Minimum 968771.60
Maximum 1264740.50
Spread ( max - min ) 295968.90
Range [ ( max - min ) / 2 * 100% ] 13.41%
Damage
Sample Data Shaman_Elemental_T20M Damage
Count 7685
Mean 297401269.89
Minimum 214462567.00
Maximum 384952887.96
Spread ( max - min ) 170490320.96
Range [ ( max - min ) / 2 * 100% ] 28.66%
DTPS
Sample Data Shaman_Elemental_T20M Damage Taken Per Second
Count 7685
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shaman_Elemental_T20M Healing Per Second
Count 7685
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Shaman_Elemental_T20M Healing Per Second (Effective)
Count 7685
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shaman_Elemental_T20M Heal
Count 7685
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shaman_Elemental_T20M Healing Taken Per Second
Count 7685
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shaman_Elemental_T20M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Shaman_Elemental_T20MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Shaman_Elemental_T20M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.96 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.15 totem_mastery,if=buff.resonance_totem.remains<2
9 3.33 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 7.79 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.32 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.16 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 21.23 elemental_blast
Keep your EB always on Cooldown.
I 11.23 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.23 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.33 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.51 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 55.91 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 30.57 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.46 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 3.63 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 1.96 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 17.17 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 64.25 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNSSNSOSMSHMSSSIAMSSMMSSHPMSSMKNMNNNSSMHORRMMPRSSSHMSJIMSKMNNHMMNNFSMSAMSHISS97MSSMSKGHMGMGMFNSSPHMQSSSSAMJSIHSKMLNNNNFMMHARRSMISSSSHMSOSKGGMGNSHMISSMSMMPSHSJMSOSSKNMHNNNSSAM9MIRRHMRSSPSMOSSHKMMGMGNM8NMHMSPAMSMJLLLIHMMOSKNNMNANSHSSMSSISSMSHSSMMFPKMNNMHNRNR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.874 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.937 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:03.952 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:04.969 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:05.987 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:06.751 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:07.514 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:08.293 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:09.070 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom bloodlust, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:09.848 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:10.626 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.403 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.184 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.221 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.308 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.395 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.480 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.298 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.386 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:19.450 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.515 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.313 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.313 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.379 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.444 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.509 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.309 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.375 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.442 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.509 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.575 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.375 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.140 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.156 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.173 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:34.188 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:35.205 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:35.968 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:36.732 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:37.494 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:38.257 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, extracted_sanity, potion_of_prolonged_power
0:39.036 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:40.072 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:41.136 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:42.518 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:43.902 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:44.941 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:46.324 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.736 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.795 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.206 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.266 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.677 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.088 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.499 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.911 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.323 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.735 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.120 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.157 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.195 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.233 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:05.272 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:06.655 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
1:08.037 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
1:09.075 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:10.134 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:11.729 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
1:12.768 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
1:14.151 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
1:15.188 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
1:16.226 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:17.264 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.677 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.736 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.146 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.146 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.559 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.970 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.383 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.444 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:27.791 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:29.137 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:30.147 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:30.147 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:31.492 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:32.838 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:34.183 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:35.193 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:36.540 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:38.036 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:39.074 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:40.457 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:41.842 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
1:42.901 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, potion_of_prolonged_power
1:43.960 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, potion_of_prolonged_power
1:45.020 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, extracted_sanity, potion_of_prolonged_power
1:46.431 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:47.492 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:48.551 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.961 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.371 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.430 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.865 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.276 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.032 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.443 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.827 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.211 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.594 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.594 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.977 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.034 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.093 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.153 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.564 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.624 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:10.034 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
2:11.444 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
2:12.504 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
2:13.563 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
2:14.623 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
2:15.683 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
2:16.743 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:17.801 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:18.861 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:20.272 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.683 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.683 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.094 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.505 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.916 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.329 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.388 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:29.801 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.213 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.626 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.038 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:35.448 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:36.793 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:38.139 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:39.149 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:40.497 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:41.817 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, mark_of_the_claw
2:42.810 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, mark_of_the_claw
2:43.800 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, mark_of_the_claw
2:45.120 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, mark_of_the_claw
2:46.110 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:47.150 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.562 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.972 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.318 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.328 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.674 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.020 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.032 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.377 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.367 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.688 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.678 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.062 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.444 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.856 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.914 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:07.324 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.385 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.444 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:10.504 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.564 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.224 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:14.284 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
3:15.694 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:17.104 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:18.094 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:19.084 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:20.076 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:21.397 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:22.717 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:22.717 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:24.035 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:25.046 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:26.056 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:27.067 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:28.414 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.823 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:31.206 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:32.527 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:33.847 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:35.166 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:36.485 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:37.496 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.843 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:40.190 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:41.201 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:42.547 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:43.957 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:45.368 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:46.713 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity
3:47.723 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:48.732 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:49.741 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
3:51.086 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
3:52.096 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:53.105 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:54.116 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:54.871 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:55.882 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.292 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.777 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:59.815 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:01.135 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:02.126 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:02.126 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:03.118 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:04.437 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.784 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.924 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.934 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.945 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.957 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.014 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.425 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:13.438 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:14.784 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.794 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:17.141 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:18.488 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:19.498 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:20.509 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:21.856 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:22.867 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:22.867 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:23.927 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.339 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.749 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.160 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:29.480 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:30.799 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:32.119 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:33.438 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:34.429 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.777 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:37.122 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:38.469 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:39.880 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:41.291 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:42.638 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:43.984 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:44.997 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:46.342 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:47.351 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.363 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.829 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:50.840 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:51.851 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:52.912 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:54.324 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:55.735 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:56.793 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:58.204 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:59.263 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81584 81584 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 4895040 4895040 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="baseline"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

ctt_nature : 1121391 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1121391.3 1121391.3 896.2 / 0.080% 156146.1 / 13.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 52.7 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ctt_nature 1121391
Earth Shock 105206 9.4% 15.5 18.69sec 2038325 2035967 Direct 15.5 1414084 3915926 2038202 25.0%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.48 15.48 0.00 0.00 1.0012 0.0000 31555460.09 31555460.09 0.00 2035967.49 2035967.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.62 75.05% 1414083.71 1183055 1664698 1414445.41 1300175 1538630 16429503 16429503 0.00
crit 3.86 24.95% 3915926.30 3274696 4607884 3873332.10 0 4607884 15125957 15125957 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 64193 (98247) 5.7% (8.8%) 22.0 13.81sec 1338334 984973 Direct 22.0 611320 1692964 876583 24.5%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 21.96 0.00 0.00 1.3588 0.0000 19246030.04 19246030.04 0.00 984973.27 984973.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.57 75.47% 611320.32 543294 678857 611491.61 577050 648112 10130116 10130116 0.00
crit 5.38 24.53% 1692963.73 1503838 1879077 1689107.04 0 1879077 9115914 9115914 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 34054 3.0% 13.9 21.09sec 733470 0 Direct 13.9 513568 1422843 735330 24.4%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.92 13.88 0.00 0.00 0.0000 0.0000 10209595.58 10209595.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.50 75.61% 513567.65 456367 570240 513662.07 471579 555175 5391743 5391743 0.00
crit 3.39 24.39% 1422843.11 1263224 1578425 1380537.16 0 1578425 4817852 4817852 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 120772 10.8% 11.2 27.77sec 3223951 3289052 Direct 11.2 88099 247484 209241 76.0%  
Periodic 226.4 48566 185233 149268 73.7% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 226.44 226.44 0.9802 1.3169 36146681.54 36146681.54 0.00 116911.07 3289052.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.69 23.99% 88098.94 78852 98528 86870.79 0 98528 236986 236986 0.00
crit 8.52 76.01% 247483.93 218264 272724 247529.94 228262 263293 2109033 2109033 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.6 26.31% 48566.24 136 54191 48563.14 44283 51510 2893589 2893589 0.00
crit 166.9 73.69% 185232.67 131 210001 185325.75 173421 195596 30907074 30907074 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123380 11.0% 38.2 7.56sec 966946 982809 Direct 38.2 667114 1848814 966936 25.4%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.22 38.22 0.00 0.00 0.9839 0.0000 36960498.88 36960498.88 0.00 982809.02 982809.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.53 74.63% 667113.94 597367 746421 667398.47 637907 708914 19029697 19029697 0.00
crit 9.70 25.37% 1848814.24 1570836 2066092 1848249.56 1694849 2020224 17930801 17930801 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35385 (54362) 3.2% (4.8%) 9.7 32.21sec 1684822 1285246 Direct 9.6 756506 2097894 1099699 25.6%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.66 9.64 0.00 0.00 1.3109 0.0000 10600189.02 10600189.02 0.00 1285246.28 1285246.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.17 74.42% 756506.05 672025 839709 756759.67 685466 839709 5427748 5427748 0.00
crit 2.47 25.58% 2097894.03 1860166 2324315 1964281.88 0 2324315 5172441 5172441 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18977 1.7% 6.2 47.35sec 922211 0 Direct 6.1 635799 1762296 924531 25.6%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.16 6.14 0.00 0.00 0.0000 0.0000 5680025.56 5680025.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.57 74.37% 635799.08 564501 705356 634207.26 0 705356 2904971 2904971 0.00
crit 1.57 25.63% 1762296.49 1562539 1952425 1446909.30 0 1952425 2775055 2775055 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Insidious Corruption 14605 1.3% 5.1 60.44sec 856970 0 Periodic 48.0 73688 150225 91413 23.2% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 0.00 47.98 47.98 0.0000 1.2495 4386091.59 4386091.59 0.00 73161.27 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 76.84% 73688.13 109 76542 73678.60 69313 76542 2716702 2716702 0.00
crit 11.1 23.16% 150224.85 222 156146 150220.41 98223 156146 1669390 1669390 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 150153 (235802) 13.4% (21.1%) 58.0 5.11sec 1219056 1010275 Direct 57.9 0 778202 778202 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.00 57.86 0.00 0.00 1.2067 0.0000 45024912.11 45024912.11 0.00 1010274.99 1010274.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 57.86 100.00% 778202.40 701650 876726 778327.93 751962 807448 45024912 45024912 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77176 6.9% 36.9 7.98sec 626519 0 Direct 36.8 0 628609 628609 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.94 36.82 0.00 0.00 0.0000 0.0000 23146177.19 23146177.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 36.82 100.00% 628608.99 566884 708333 628704.62 605968 661784 23146177 23146177 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8474 0.8% 43.1 6.29sec 58936 0 Direct 43.1 46930 95755 58937 24.6%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.10 43.10 0.00 0.00 0.0000 0.0000 2540077.77 2540077.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.50 75.41% 46930.17 44808 50897 46940.35 44808 49883 1525248 1525248 0.00
crit 10.60 24.59% 95754.81 91408 103831 95752.88 0 103831 1014830 1014830 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 103594 (190634) 9.2% (17.0%) 89.2 3.28sec 640635 507920 Direct 89.2 243998 667222 348111 24.6%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.17 89.17 0.00 0.00 1.2613 0.0000 31040627.85 31040627.85 0.00 507920.17 507920.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.23 75.40% 243997.86 160793 602740 244173.59 203079 291202 16404799 16404799 0.00
crit 21.93 24.60% 667221.74 445074 1668385 667711.28 481315 1019937 14635829 14635829 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 87040 7.8% 87.9 4.10sec 296683 0 Direct 87.9 208273 568961 296676 24.5%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.92 87.92 0.00 0.00 0.0000 0.0000 26083121.51 26083121.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.37 75.49% 208272.52 135066 506302 208264.63 166429 272351 13822809 13822809 0.00
crit 21.55 24.51% 568960.56 373862 1401444 568848.27 400566 982791 12260312 12260312 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45524 (66619) 4.0% (5.9%) 3.0 120.39sec 6649955 0 Direct 94.1 116064 236771 143933 23.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 94.14 94.14 0.00 0.0000 0.6137 13550873.09 13550873.09 0.00 343219.60 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.41 76.91% 116064.33 116064 116064 116064.33 116064 116064 8403681 8403681 0.00
crit 21.74 23.09% 236771.23 236771 236771 236771.23 236771 236771 5147193 5147193 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21094 1.9% 37.5 7.00sec 167428 0 Direct 37.4 135409 276235 168076 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.51 37.36 0.00 0.00 0.0000 0.0000 6279668.70 6279668.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.69 76.80% 135409.19 135409 135409 135409.19 135409 135409 3885526 3885526 0.00
crit 8.67 23.20% 276234.76 276235 276235 276198.58 0 276235 2394143 2394143 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 134429 / 86267
Fire Blast 134429 7.7% 97.0 3.00sec 265600 136825 Direct 97.0 213199 426394 265606 24.6%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.02 97.02 0.00 0.00 1.9412 0.0000 25769416.99 25769416.99 0.00 136825.37 136825.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.18 75.42% 213198.66 201607 229011 213253.64 207056 221103 15600832 15600832 0.00
crit 23.85 24.58% 426394.11 403214 458023 426503.36 412214 446943 10168585 10168585 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 179329 / 25498
Lightning Blast 179329 2.3% 39.5 7.13sec 193017 196329 Direct 39.5 156600 313205 193017 23.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.54 39.54 0.00 0.00 0.9831 0.0000 7632302.16 7632302.16 0.00 196329.32 196329.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.35 76.75% 156599.81 149339 169638 156636.08 151039 166236 4752263 4752263 0.00
crit 9.20 23.25% 313205.28 298677 339276 313136.16 0 339276 2880039 2880039 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ctt_nature
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 105.85sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.47 0.00 0.00 0.00 1.0422 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.64sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8406 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.06sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5185 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.24% 32.24% 3.1(3.1) 8.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.5 1.4 27.4sec 23.8sec 34.58% 34.58% 1.4(1.4) 10.1

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.7sec 34.80% 34.80% 1.4(1.4) 10.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 28.0sec 23.5sec 33.77% 33.77% 1.8(1.8) 9.9

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.3 27.3 4.2sec 3.0sec 60.54% 63.54% 27.3(33.9) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:26.63%
  • elemental_focus_2:33.90%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.15% 19.15% 0.0(0.0) 4.7

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.2sec 32.2sec 21.25% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.61%
  • icefury_2:6.14%
  • icefury_3:5.18%
  • icefury_4:3.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 21.3 1.3 13.6sec 12.8sec 10.18% 38.40% 1.3(1.3) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.18%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.92% 29.92% 4.2(4.2) 12.6

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 94.3sec 0.0sec 39.92% 39.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.3 1.5 37.7sec 30.8sec 22.54% 25.36% 1.5(3.0) 0.1

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.40%
  • power_of_the_maelstrom_2:6.56%
  • power_of_the_maelstrom_3:9.58%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 13.00% 9.63% 0.0(0.0) 0.3

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.57%
  • stormkeeper_2:3.83%
  • stormkeeper_3:4.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.0sec 100.00% 98.19% 2.2(2.2) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 22.6 12.8sec
Lava Surge: Wasted 1.3 80.2sec
Lava Surge: During Lava Burst 3.7 58.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7150.0014.7502.6180.00010.026
Fire Elemental0.5010.0011.5860.5790.0003.398
Lava Burst0.9340.0018.2067.4620.00028.539
Elemental Blast0.5540.0014.4929.2972.96017.608
Icefury1.0570.0018.4767.7450.88223.173

Resources

Resource Usage Type Count Total Average RPE APR
ctt_nature
earth_shock Maelstrom 119.2 14305.2 120.1 924.0 2205.9
flame_shock Maelstrom 86.3 1538.9 17.8 137.3 23488.8
frost_shock Maelstrom 294.2 5884.1 20.0 153.9 6281.4
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 446.46 5300.58 (23.93%) 11.87 56.90 1.06%
Lava Burst Overload Maelstrom 284.34 2467.51 (11.14%) 8.68 91.55 3.58%
Lightning Bolt Maelstrom 686.31 5475.44 (24.72%) 7.98 15.05 0.27%
Lightning Bolt Overload Maelstrom 676.68 4010.10 (18.11%) 5.93 50.01 1.23%
Icefury Maelstrom 74.38 1775.26 (8.02%) 23.87 9.78 0.55%
Icefury Overload Maelstrom 47.41 843.91 (3.81%) 17.80 9.39 1.10%
Resonance Totem Maelstrom 2297.32 2274.93 (10.27%) 0.99 22.38 0.97%
Resource RPS-Gain RPS-Loss
Maelstrom 9.59 9.41
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 52.95 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ctt_nature Fight Length
Count 7635
Mean 300.01
Minimum 239.94
Maximum 360.03
Spread ( max - min ) 120.09
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 36.1141
5th Percentile 245.39
95th Percentile 354.60
( 95th Percentile - 5th Percentile ) 109.21
Mean Distribution
Standard Deviation 0.4133
95.00% Confidence Intervall ( 299.20 - 300.82 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 557
0.1% Error 55667
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1114
DPS
Sample Data ctt_nature Damage Per Second
Count 7635
Mean 1121391.32
Minimum 993392.91
Maximum 1295723.29
Spread ( max - min ) 302330.38
Range [ ( max - min ) / 2 * 100% ] 13.48%
Standard Deviation 39952.0135
5th Percentile 1058415.29
95th Percentile 1190332.45
( 95th Percentile - 5th Percentile ) 131917.16
Mean Distribution
Standard Deviation 457.2294
95.00% Confidence Intervall ( 1120495.17 - 1122287.47 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4876
0.1 Scale Factor Error with Delta=300 13625769
0.05 Scale Factor Error with Delta=300 54503075
0.01 Scale Factor Error with Delta=300 1362576870
Priority Target DPS
Sample Data ctt_nature Priority Target Damage Per Second
Count 7635
Mean 1121391.32
Minimum 993392.91
Maximum 1295723.29
Spread ( max - min ) 302330.38
Range [ ( max - min ) / 2 * 100% ] 13.48%
Standard Deviation 39952.0135
5th Percentile 1058415.29
95th Percentile 1190332.45
( 95th Percentile - 5th Percentile ) 131917.16
Mean Distribution
Standard Deviation 457.2294
95.00% Confidence Intervall ( 1120495.17 - 1122287.47 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4876
0.1 Scale Factor Error with Delta=300 13625769
0.05 Scale Factor Error with Delta=300 54503075
0.01 Scale Factor Error with Delta=300 1362576870
DPS(e)
Sample Data ctt_nature Damage Per Second (Effective)
Count 7635
Mean 1121391.32
Minimum 993392.91
Maximum 1295723.29
Spread ( max - min ) 302330.38
Range [ ( max - min ) / 2 * 100% ] 13.48%
Damage
Sample Data ctt_nature Damage
Count 7635
Mean 302450030.53
Minimum 219868875.59
Maximum 389279145.93
Spread ( max - min ) 169410270.34
Range [ ( max - min ) / 2 * 100% ] 28.01%
DTPS
Sample Data ctt_nature Damage Taken Per Second
Count 7635
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ctt_nature Healing Per Second
Count 7635
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ctt_nature Healing Per Second (Effective)
Count 7635
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ctt_nature Heal
Count 7635
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ctt_nature Healing Taken Per Second
Count 7635
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ctt_nature Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ctt_natureTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ctt_nature Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.95 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.15 totem_mastery,if=buff.resonance_totem.remains<2
9 3.31 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 7.73 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.28 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.16 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 21.10 elemental_blast
Keep your EB always on Cooldown.
I 11.11 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.20 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.27 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.50 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 55.52 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 30.32 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.42 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 3.66 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 1.94 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 17.14 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 63.78 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNNSSMOSMSHSSSISAMMSSSSPHMSSSKNMGNNSMMHOSSPMSSSSHMSJISSSKMNNHNNMSFSSMMAIHMSS97MSSMPRHKMMNNNNFRMQHRSSMSSIAJSSHMSOSKNMNNNSHMRAMRRISMSHSSMSOSSSPKHMNNSMNNSSSHMJOSSSSMIRRHRKMGN9ANNMSHSSSMISSOSMHQSSSSKGGMGHMGMISAOSJMSSHSSMISSSSKMAGHMGGNMSOMPRHMMRMPRSMMSHKMGMGNN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.963 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.051 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:05.138 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:06.224 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:07.041 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
0:07.858 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:08.675 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:09.493 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.310 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.128 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.944 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.761 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.577 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.663 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.749 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.835 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.922 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.008 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.074 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.873 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.938 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.938 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.738 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.803 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.869 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.935 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.000 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.066 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.864 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.952 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.016 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.081 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.146 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:34.211 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:35.276 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:36.077 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
0:36.894 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
0:37.711 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, potion_of_prolonged_power
0:38.528 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, extracted_sanity, potion_of_prolonged_power
0:39.347 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:40.434 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:41.250 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:42.662 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:44.073 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:45.132 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:46.543 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.956 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.015 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.425 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:51.809 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:53.193 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:54.577 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:55.960 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:57.453 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:58.772 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:00.093 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:01.084 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.077 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.087 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.098 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:05.091 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:06.592 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
1:07.913 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
1:08.953 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
1:09.992 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
1:11.375 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:12.415 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:13.452 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:14.836 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.247 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.307 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.719 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:20.102 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:21.139 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:22.178 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:22.178 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:23.217 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:24.754 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.165 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.511 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.858 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.009 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.009 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.356 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.701 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:34.048 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.058 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:36.068 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:37.451 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:38.833 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:40.217 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:41.208 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:42.554 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:43.565 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:44.574 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:45.585 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:46.596 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:47.606 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.952 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.299 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.053 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.465 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.812 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.158 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.504 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.850 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.196 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.543 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.554 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.554 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.564 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.623 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:04.660 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:06.044 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:07.362 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:08.356 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:09.348 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.693 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.039 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:13.049 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:14.393 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:15.402 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:16.412 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:17.423 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:18.835 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:20.246 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:21.658 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:23.070 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:23.070 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:24.130 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:25.514 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:26.898 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:27.938 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:29.321 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:30.705 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:32.087 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:33.625 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:34.973 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:36.320 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:37.641 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:38.962 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:39.953 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:41.273 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:42.592 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:43.912 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:44.952 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:46.336 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity
2:47.748 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:49.159 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:50.218 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:51.276 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:52.687 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:54.071 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:55.111 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:56.149 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:57.531 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:58.914 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.325 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:01.735 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:03.082 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:04.092 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.103 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:06.096 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.088 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.079 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.399 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.720 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.712 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.032 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:14.415 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:15.799 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:17.119 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:18.439 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:19.758 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:20.769 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:21.781 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:23.011 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:23.011 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:24.022 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:25.034 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.382 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.793 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.178 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.499 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.818 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.140 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.460 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.470 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:36.813 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.159 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:39.170 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:40.516 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:41.928 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:43.339 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:44.095 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:45.442 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:46.788 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:48.135 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.479 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.825 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:51.837 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:52.846 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:54.192 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:55.232 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:56.718 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:57.710 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:58.703 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.023 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.033 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.379 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.379 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.389 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.735 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.744 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.091 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.101 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.162 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.573 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:11.632 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:12.979 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:14.327 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.338 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:16.683 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:18.029 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:19.374 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.720 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:22.142 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
4:23.181 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
4:23.181 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
4:24.219 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
4:25.602 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
4:26.984 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:28.046 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:29.108 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:30.168 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:31.551 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:32.933 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:33.974 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:35.013 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:36.050 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:37.462 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:39.010 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:40.420 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:41.430 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:42.777 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:43.767 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:44.758 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:46.078 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:47.400 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:48.391 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.736 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.148 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.559 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.969 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:54.978 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:55.990 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:57.336 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:58.346 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:59.356 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ctt_nature"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:7:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

ea_es : 1120935 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1120934.6 1120934.6 895.8 / 0.080% 158068.2 / 14.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 52.7 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ea_es 1120935
Earth Shock 112400 10.0% 15.5 18.66sec 2176422 2174070 Direct 15.5 1517430 4201160 2176459 24.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.49 15.49 0.00 0.00 1.0011 0.0000 33713308.12 33713308.12 0.00 2174070.30 2174070.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.69 75.45% 1517429.61 1268839 1785406 1517884.89 1400466 1663266 17733799 17733799 0.00
crit 3.80 24.55% 4201159.67 3512145 4942003 4140742.86 0 4942003 15979509 15979509 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 62411 (95502) 5.6% (8.5%) 22.0 13.81sec 1301145 957606 Direct 22.0 594122 1645205 852495 24.6%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 21.96 0.00 0.00 1.3588 0.0000 18717118.01 18717118.01 0.00 957605.85 957605.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.56 75.42% 594121.63 528062 659824 594276.43 562454 631316 9838460 9838460 0.00
crit 5.40 24.58% 1645205.05 1461674 1826393 1641682.93 0 1826393 8878658 8878658 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33091 3.0% 13.9 21.11sec 711626 0 Direct 13.9 499105 1381611 713213 24.3%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.94 13.91 0.00 0.00 0.0000 0.0000 9919127.21 9919127.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.53 75.73% 499105.33 443572 554252 499219.10 458357 541701 5256814 5256814 0.00
crit 3.37 24.27% 1381610.68 1227806 1534170 1343332.25 0 1534170 4662313 4662313 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 120788 10.8% 11.2 27.80sec 3223264 3287989 Direct 11.2 88096 247467 209176 76.0%  
Periodic 226.4 48556 185250 149293 73.7% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 226.43 226.43 0.9804 1.3169 36151444.13 36151444.13 0.00 116929.50 3287989.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.69 24.02% 88095.84 78852 98528 86998.02 0 96614 237363 237363 0.00
crit 8.52 75.98% 247467.36 218264 272724 247522.44 231517 263487 2108776 2108776 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.6 26.30% 48555.95 271 54191 48549.65 44844 51355 2891940 2891940 0.00
crit 166.9 73.70% 185249.56 188 210001 185348.39 172176 195156 30913365 30913365 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123048 11.0% 38.2 7.57sec 964446 980295 Direct 38.2 667098 1849259 964411 25.2%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.23 38.23 0.00 0.00 0.9838 0.0000 36873813.01 36873813.01 0.00 980295.44 980295.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.62 74.85% 667098.18 561357 746421 667394.22 636718 706958 19089927 19089927 0.00
crit 9.62 25.15% 1849258.93 1596997 2066092 1849144.76 1653511 2039336 17783886 17783886 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35718 (54706) 3.2% (4.9%) 9.7 32.22sec 1694475 1292873 Direct 9.6 756303 2095574 1108823 26.3%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.67 9.65 0.00 0.00 1.3107 0.0000 10694665.09 10694665.09 0.00 1292873.28 1292873.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.11 73.68% 756303.14 672025 839709 756569.40 679440 823397 5375326 5375326 0.00
crit 2.54 26.32% 2095573.59 1860166 2324315 1982106.13 0 2324315 5319339 5319339 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18989 1.7% 6.2 46.76sec 921634 0 Direct 6.2 635426 1760825 923977 25.6%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.17 6.16 0.00 0.00 0.0000 0.0000 5688625.10 5688625.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.58 74.36% 635425.86 564501 705356 634053.89 0 705356 2909001 2909001 0.00
crit 1.58 25.64% 1760824.91 1562539 1952425 1439413.46 0 1952425 2779624 2779624 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Insidious Corruption 14601 1.3% 5.1 60.45sec 855846 0 Periodic 48.0 73706 150260 91396 23.1% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 0.00 47.98 47.98 0.0000 1.2496 4384852.76 4384852.76 0.00 73141.83 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 76.89% 73706.47 109 76542 73698.72 69470 76542 2718982 2718982 0.00
crit 11.1 23.11% 150259.68 222 156146 150250.41 113030 156146 1665871 1665871 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 150475 (236290) 13.4% (21.1%) 58.1 5.12sec 1219117 1010944 Direct 58.0 0 778283 778283 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.12 57.97 0.00 0.00 1.2059 0.0000 45117218.34 45117218.34 0.00 1010943.63 1010943.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 57.97 100.00% 778283.06 701650 876726 778403.75 754435 814693 45117218 45117218 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77314 6.9% 37.0 8.00sec 626857 0 Direct 36.9 0 628811 628811 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.99 36.87 0.00 0.00 0.0000 0.0000 23185303.39 23185303.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 36.87 100.00% 628810.73 566884 708333 628905.81 605921 658873 23185303 23185303 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8501 0.8% 43.3 6.30sec 58940 0 Direct 43.3 46941 95714 58941 24.6%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.26 43.26 0.00 0.00 0.0000 0.0000 2549462.31 2549462.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.61 75.40% 46941.34 44808 50897 46953.30 44935 49426 1530942 1530942 0.00
crit 10.64 24.60% 95713.83 91408 103831 95721.42 0 103831 1018520 1018520 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 100520 (185006) 9.0% (16.5%) 89.1 3.27sec 622453 493507 Direct 89.1 237086 649199 338137 24.5%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.08 89.08 0.00 0.00 1.2613 0.0000 30121226.87 30121226.87 0.00 493507.23 493507.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.23 75.48% 237086.44 156284 585841 237281.19 197614 274334 15939994 15939994 0.00
crit 21.84 24.52% 649198.54 432595 1621608 649485.37 468367 1012824 14181233 14181233 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 84486 7.5% 88.0 4.09sec 287892 0 Direct 88.0 202564 551305 287887 24.5%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.96 87.96 0.00 0.00 0.0000 0.0000 25323817.20 25323817.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.44 75.54% 202564.06 131279 492107 202537.02 158887 267666 13458819 13458819 0.00
crit 21.52 24.46% 551304.79 363380 1362151 551198.10 394380 893695 11864998 11864998 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45611 (66752) 4.0% (5.9%) 3.0 120.40sec 6661162 0 Direct 94.3 116064 236771 143963 23.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 94.31 94.31 0.00 0.0000 0.6138 13577487.39 13577487.39 0.00 343288.05 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.51 76.89% 116064.33 116064 116064 116064.33 116064 116064 8416223 8416223 0.00
crit 21.80 23.11% 236771.23 236771 236771 236771.23 236771 236771 5161265 5161265 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21141 1.9% 37.6 7.04sec 167474 0 Direct 37.4 135409 276235 168101 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.58 37.44 0.00 0.00 0.0000 0.0000 6293741.12 6293741.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.75 76.79% 135409.19 135409 135409 135409.19 135409 135409 3892963 3892963 0.00
crit 8.69 23.21% 276234.76 276235 276235 276199.76 0 276235 2400778 2400778 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 134545 / 86333
Fire Blast 134545 7.7% 97.0 3.00sec 265809 136935 Direct 97.0 213194 426514 265808 24.7%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.02 97.02 0.00 0.00 1.9411 0.0000 25789846.78 25789846.78 0.00 136935.30 136935.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.09 75.34% 213194.11 201607 229011 213250.23 207555 221443 15583256 15583256 0.00
crit 23.93 24.66% 426513.71 403214 458023 426631.22 410909 445820 10206591 10206591 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 179258 / 25508
Lightning Blast 179258 2.3% 39.6 7.15sec 192980 196259 Direct 39.6 156537 313191 192971 23.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.57 39.57 0.00 0.00 0.9833 0.0000 7636036.52 7636036.52 0.00 196258.78 196258.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.36 76.74% 156536.98 149339 169638 156574.23 150485 166474 4753226 4753226 0.00
crit 9.20 23.26% 313190.87 298677 339276 313284.69 298677 339276 2882811 2882811 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ea_es
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 105.67sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.47 0.00 0.00 0.00 1.0420 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.64sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8410 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.01sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.19 0.00 0.00 0.00 0.5180 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.23% 32.23% 3.1(3.1) 8.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.5 1.4 27.3sec 23.8sec 34.69% 34.69% 1.4(1.4) 10.2

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.7sec 34.87% 34.87% 1.4(1.4) 10.2

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 28.0sec 23.5sec 33.77% 33.77% 1.8(1.8) 9.9

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.3 27.2 4.2sec 3.0sec 60.42% 63.47% 27.2(33.8) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:26.56%
  • elemental_focus_2:33.86%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.14% 19.14% 0.0(0.0) 4.7

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.2sec 32.2sec 21.27% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.64%
  • icefury_2:6.12%
  • icefury_3:5.19%
  • icefury_4:3.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 21.4 1.3 13.5sec 12.7sec 10.24% 38.54% 1.3(1.3) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.24%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.0sec 17.0sec 29.96% 29.96% 4.2(4.2) 12.7

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 94.3sec 0.0sec 39.90% 39.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.3 1.4 37.4sec 30.6sec 22.66% 25.50% 1.4(2.9) 0.1

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.47%
  • power_of_the_maelstrom_2:6.62%
  • power_of_the_maelstrom_3:9.58%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 13.11% 9.64% 0.0(0.0) 0.3

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.60%
  • stormkeeper_2:3.86%
  • stormkeeper_3:4.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 112.9sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 22.7 12.7sec
Lava Surge: Wasted 1.3 78.8sec
Lava Surge: During Lava Burst 3.7 57.6sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7160.0015.4132.6260.0008.915
Fire Elemental0.5130.0011.6010.5910.0003.407
Lava Burst0.9330.0017.8797.5210.00025.659
Elemental Blast0.5520.0015.0529.2732.42918.872
Icefury1.0600.0018.6967.7910.64723.559

Resources

Resource Usage Type Count Total Average RPE APR
ea_es
earth_shock Maelstrom 121.2 14551.2 120.1 939.4 2316.9
flame_shock Maelstrom 87.7 1565.5 17.8 139.6 23093.0
frost_shock Maelstrom 299.1 5981.1 20.0 156.4 6165.0
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 454.59 5396.18 (23.96%) 11.87 58.94 1.08%
Lava Burst Overload Maelstrom 289.31 2511.85 (11.15%) 8.68 91.94 3.53%
Lightning Bolt Maelstrom 696.71 5558.29 (24.68%) 7.98 15.41 0.28%
Lightning Bolt Overload Maelstrom 688.03 4077.18 (18.11%) 5.93 51.02 1.24%
Icefury Maelstrom 75.63 1804.17 (8.01%) 23.86 10.90 0.60%
Icefury Overload Maelstrom 48.28 858.62 (3.81%) 17.78 10.49 1.21%
Resonance Totem Maelstrom 2334.51 2311.69 (10.27%) 0.99 22.82 0.98%
Resource RPS-Gain RPS-Loss
Maelstrom 9.60 9.42
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.53 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ea_es Fight Length
Count 7892
Mean 300.00
Minimum 239.99
Maximum 360.00
Spread ( max - min ) 120.01
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 35.7009
5th Percentile 245.75
95th Percentile 354.18
( 95th Percentile - 5th Percentile ) 108.42
Mean Distribution
Standard Deviation 0.4019
95.00% Confidence Intervall ( 299.21 - 300.79 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 545
0.1% Error 54403
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 44
0.01 Scale Factor Error with Delta=300 1089
DPS
Sample Data ea_es Damage Per Second
Count 7892
Mean 1120934.57
Minimum 995085.76
Maximum 1278516.73
Spread ( max - min ) 283430.97
Range [ ( max - min ) / 2 * 100% ] 12.64%
Standard Deviation 40603.1889
5th Percentile 1057114.36
95th Percentile 1191921.71
( 95th Percentile - 5th Percentile ) 134807.35
Mean Distribution
Standard Deviation 457.0530
95.00% Confidence Intervall ( 1120038.77 - 1121830.38 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5041
0.1 Scale Factor Error with Delta=300 14073560
0.05 Scale Factor Error with Delta=300 56294239
0.01 Scale Factor Error with Delta=300 1407355960
Priority Target DPS
Sample Data ea_es Priority Target Damage Per Second
Count 7892
Mean 1120934.57
Minimum 995085.76
Maximum 1278516.73
Spread ( max - min ) 283430.97
Range [ ( max - min ) / 2 * 100% ] 12.64%
Standard Deviation 40603.1889
5th Percentile 1057114.36
95th Percentile 1191921.71
( 95th Percentile - 5th Percentile ) 134807.35
Mean Distribution
Standard Deviation 457.0530
95.00% Confidence Intervall ( 1120038.77 - 1121830.38 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5041
0.1 Scale Factor Error with Delta=300 14073560
0.05 Scale Factor Error with Delta=300 56294239
0.01 Scale Factor Error with Delta=300 1407355960
DPS(e)
Sample Data ea_es Damage Per Second (Effective)
Count 7892
Mean 1120934.57
Minimum 995085.76
Maximum 1278516.73
Spread ( max - min ) 283430.97
Range [ ( max - min ) / 2 * 100% ] 12.64%
Damage
Sample Data ea_es Damage
Count 7892
Mean 302311210.05
Minimum 216080121.21
Maximum 386017294.13
Spread ( max - min ) 169937172.93
Range [ ( max - min ) / 2 * 100% ] 28.11%
DTPS
Sample Data ea_es Damage Taken Per Second
Count 7892
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ea_es Healing Per Second
Count 7892
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ea_es Healing Per Second (Effective)
Count 7892
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ea_es Heal
Count 7892
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ea_es Healing Taken Per Second
Count 7892
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ea_es Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ea_esTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ea_es Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.99 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.16 totem_mastery,if=buff.resonance_totem.remains<2
9 3.42 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.43 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.35 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 21.81 elemental_blast
Keep your EB always on Cooldown.
I 11.56 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.35 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.58 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.67 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 57.50 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.36 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.64 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 3.72 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.00 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 17.81 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 65.72 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNNSOSSSMSHMSSISAMSSSSSSHIMSSKMGNMNNORHMRMRISSSMSHSMJPMMSKNNNHMNOSSSMRRARHIMS97SMRRMIHKNMMNNFRNSHMQRRMMIAJLSSHMSOKNMGMNNHSSAMPRRRSMHMISSMMMKNNNFHMNSSSMMSISHJMMSOSS9SKGGHMGMGARPRRMMHRRIRMSOSMSHKGMNN8MNSSHSAMISJSSSMSHSPFMKNNNASMHNSSOSMRRRIHMMSSSSSMIKHMNNN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.943 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:03.959 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:04.974 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:05.991 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:06.754 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:07.517 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:08.294 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:09.072 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.851 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.630 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.408 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.187 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.223 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.310 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.397 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.484 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.300 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.385 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.472 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.290 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.356 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.356 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.421 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.486 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.552 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.616 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.681 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.766 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.851 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.938 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.716 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.751 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.787 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.824 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:34.992 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:35.771 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:36.549 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:37.328 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:38.345 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.108 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.873 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:40.637 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:41.704 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:43.317 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:44.328 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:45.675 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:46.994 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:48.314 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.306 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:50.627 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:51.947 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.294 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:54.615 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:55.998 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:57.382 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:58.764 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
0:59.802 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.038 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.076 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.114 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.497 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.556 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.969 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:08.027 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:09.087 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:10.147 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:11.558 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:12.971 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:13.980 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.990 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.000 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.012 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.358 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:19.677 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:20.998 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:22.319 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:22.319 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:23.704 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.089 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.128 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:27.511 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:28.894 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.058 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.058 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.469 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.530 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.944 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.357 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:36.769 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:37.828 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:39.239 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:40.652 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, potion_of_prolonged_power
1:41.713 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
1:42.773 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
1:44.184 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
1:45.245 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:46.305 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:47.365 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
1:48.775 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
1:49.835 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.247 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:52.657 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.068 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.823 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.236 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.650 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.708 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.120 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.179 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.179 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.237 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.295 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:04.354 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:05.412 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.823 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:08.206 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:09.590 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:10.629 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:12.030 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
2:13.069 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:14.128 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:15.187 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:16.599 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:17.658 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:18.718 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.230 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.642 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.053 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.053 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.464 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.523 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:26.934 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.347 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:29.757 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.169 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.581 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:33.994 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:35.055 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:36.064 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:37.411 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:38.733 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:39.724 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:41.044 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:42.034 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:43.356 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity
2:44.366 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity
2:45.376 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity
2:46.434 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, extracted_sanity
2:47.493 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:48.906 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:50.317 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:51.376 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.789 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.202 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.613 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.672 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.081 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.493 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.554 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.965 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.376 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.435 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.494 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.906 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.966 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.024 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.084 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.143 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.203 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.614 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:14.995 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:16.033 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:17.071 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:18.455 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
3:19.841 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
3:20.902 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
3:22.312 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
3:23.372 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:23.372 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:24.754 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:25.791 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:27.175 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:28.559 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.942 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.001 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.412 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.823 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.234 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:36.292 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:37.705 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:39.119 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:40.531 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:41.589 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:42.999 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:44.059 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:45.469 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:46.854 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:48.236 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:49.275 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:50.658 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:51.717 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:52.776 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:53.531 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:54.941 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:56.002 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.412 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.825 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.259 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.670 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.670 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.015 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.026 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.373 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:06.364 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:07.357 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:08.351 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:09.343 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:10.665 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:12.048 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:13.667 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.080 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:16.139 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:17.198 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:18.611 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.021 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:21.080 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:22.140 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:23.200 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:23.200 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:24.609 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:26.021 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:27.432 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:28.493 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.842 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.189 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.199 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.546 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.893 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.240 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:37.562 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:38.882 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:39.920 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:41.304 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:42.344 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:43.754 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:45.138 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:46.522 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:47.905 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:49.285 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.697 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.757 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.817 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.228 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:55.640 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:57.050 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:58.059 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:59.068 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ea_es"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:7:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

ede_crit : 1145014 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1145014.3 1145014.3 915.3 / 0.080% 162942.8 / 14.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 52.7 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ede_crit 1145014
Earth Shock 104905 9.2% 15.5 18.59sec 2029430 2026658 Direct 15.5 1374795 4020464 2029647 24.7%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.51 15.51 0.00 0.00 1.0014 0.0000 31467913.65 31467913.65 0.00 2026657.67 2026657.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.67 75.26% 1374794.55 1149885 1618024 1375132.79 1251541 1488888 16042832 16042832 0.00
crit 3.84 24.74% 4020464.10 3362264 4731102 3963161.34 0 4731102 15425082 15425082 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 64034 (98032) 5.6% (8.6%) 22.0 13.81sec 1335693 983047 Direct 22.0 594225 1738373 874264 24.5%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 21.96 0.00 0.00 1.3588 0.0000 19196213.67 19196213.67 0.00 983046.93 983046.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.58 75.52% 594225.40 528062 659824 594364.01 563313 626132 9852625 9852625 0.00
crit 5.37 24.48% 1738372.74 1544052 1929325 1735131.14 0 1929325 9343589 9343589 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33998 3.0% 13.9 21.16sec 733512 0 Direct 13.9 499199 1459920 734993 24.5%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.90 13.88 0.00 0.00 0.0000 0.0000 10197872.47 10197872.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.47 75.46% 499198.84 443572 554252 499327.65 453360 548869 5226945 5226945 0.00
crit 3.40 24.54% 1459920.41 1297004 1620633 1418723.91 0 1620633 4970928 4970928 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 126999 11.1% 11.2 27.77sec 3391175 3458794 Direct 11.2 88109 261513 219751 75.9%  
Periodic 226.4 48575 195723 156983 73.7% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 226.42 226.42 0.9805 1.3170 38008686.19 38008686.19 0.00 122934.24 3458793.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.70 24.08% 88108.94 78852 98528 86938.78 0 98528 237809 237809 0.00
crit 8.51 75.92% 261513.00 230564 288094 261564.64 244016 276515 2225246 2225246 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.6 26.32% 48575.28 104 54191 48573.48 44425 51075 2895308 2895308 0.00
crit 166.8 73.68% 195722.86 303 221837 195822.25 185874 205645 32650322 32650322 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 126566 11.1% 38.2 7.57sec 992499 1008786 Direct 38.2 667029 1953228 992524 25.3%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.23 38.23 0.00 0.00 0.9839 0.0000 37938439.02 37938439.02 0.00 1008786.40 1008786.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.55 74.70% 667029.17 597367 746421 667312.45 637059 712298 19045409 19045409 0.00
crit 9.67 25.30% 1953228.26 1746701 2182534 1952784.44 1746701 2135333 18893030 18893030 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 36457 (55932) 3.2% (4.9%) 9.7 32.21sec 1734116 1323149 Direct 9.6 756596 2213305 1132599 25.8%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.67 9.64 0.00 0.00 1.3107 0.0000 10922016.20 10922016.20 0.00 1323149.10 1323149.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.15 74.18% 756596.36 672025 839709 756817.24 699478 828835 5411975 5411975 0.00
crit 2.49 25.82% 2213304.94 1965002 2455310 2090819.11 0 2455310 5510041 5510041 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 19475 1.7% 6.2 46.73sec 945781 0 Direct 6.2 635816 1861524 947645 25.4%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.18 6.16 0.00 0.00 0.0000 0.0000 5840959.74 5840959.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.60 74.56% 635815.56 564501 705356 634176.25 0 705356 2921650 2921650 0.00
crit 1.57 25.44% 1861523.90 1650601 2062461 1523151.87 0 2062461 2919310 2919310 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Insidious Corruption 14607 1.3% 5.1 60.45sec 856579 0 Periodic 48.0 73688 150266 91444 23.2% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 0.00 47.98 47.98 0.0000 1.2495 4386958.21 4386958.21 0.00 73180.61 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 76.81% 73687.84 109 76542 73683.60 69867 76542 2715561 2715561 0.00
crit 11.1 23.19% 150265.98 222 156146 150229.73 112778 156146 1671397 1671397 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 159468 (249680) 13.9% (21.8%) 58.1 5.10sec 1287724 1067612 Direct 58.0 0 824421 824421 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.15 58.00 0.00 0.00 1.2062 0.0000 47819081.04 47819081.04 0.00 1067612.09 1067612.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.00 100.00% 824421.09 743268 928728 824530.38 799662 859914 47819081 47819081 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 81668 7.1% 37.1 7.90sec 660132 0 Direct 37.0 0 662082 662082 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.11 37.00 0.00 0.00 0.0000 0.0000 24494767.05 24494767.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.00 100.00% 662081.56 597021 745990 662178.20 634135 693491 24494767 24494767 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8544 0.7% 43.5 6.25sec 58936 0 Direct 43.5 46934 95775 58937 24.6%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.47 43.47 0.00 0.00 0.0000 0.0000 2562057.99 2562057.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.79 75.43% 46934.23 44808 50897 46947.21 44966 50238 1538891 1538891 0.00
crit 10.68 24.57% 95774.51 91408 103831 95792.69 0 103831 1023167 1023167 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 103103 (189880) 9.0% (16.6%) 89.0 3.28sec 639128 506697 Direct 89.0 237166 685572 347022 24.5%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.03 89.03 0.00 0.00 1.2614 0.0000 30896967.89 30896967.89 0.00 506697.06 506697.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.22 75.50% 237166.37 156284 585841 237374.97 196618 282046 15942540 15942540 0.00
crit 21.81 24.50% 685571.95 456976 1712999 685817.02 494383 1060517 14954428 14954428 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 86777 7.6% 87.9 4.10sec 295927 0 Direct 87.9 202303 584162 295909 24.5%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.88 87.88 0.00 0.00 0.0000 0.0000 26006125.37 26006125.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.33 75.48% 202303.22 131279 492107 202333.31 156357 255710 13419684 13419684 0.00
crit 21.55 24.52% 584162.32 383859 1438919 584235.24 409013 980024 12586441 12586441 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45598 (66677) 4.0% (5.8%) 3.0 120.41sec 6654362 0 Direct 94.2 116064 236771 144040 23.2%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 94.24 94.24 0.00 0.0000 0.6137 13574834.72 13574834.72 0.00 343252.94 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.40 76.82% 116064.33 116064 116064 116064.33 116064 116064 8403096 8403096 0.00
crit 21.84 23.18% 236771.23 236771 236771 236771.23 236771 236771 5171739 5171739 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21079 1.8% 37.5 6.94sec 167259 0 Direct 37.4 135409 276235 167884 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.53 37.39 0.00 0.00 0.0000 0.0000 6276512.62 6276512.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.77 76.94% 135409.19 135409 135409 135409.19 135409 135409 3895292 3895292 0.00
crit 8.62 23.06% 276234.76 276235 276235 276234.76 276235 276235 2381220 2381220 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 134469 / 86275
Fire Blast 134469 7.5% 97.0 3.01sec 265694 136873 Direct 97.0 213198 426407 265691 24.6%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.00 97.00 0.00 0.00 1.9412 0.0000 25773534.25 25773534.25 0.00 136873.40 136873.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.12 75.38% 213197.88 201607 229011 213252.37 207693 221302 15589028 15589028 0.00
crit 23.88 24.62% 426406.60 403214 458023 426511.38 410332 446046 10184506 10184506 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 179128 / 25462
Lightning Blast 179128 2.2% 39.5 7.14sec 192804 196103 Direct 39.5 156549 313230 192799 23.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.53 39.53 0.00 0.00 0.9832 0.0000 7621559.08 7621559.08 0.00 196103.41 196103.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.38 76.86% 156549.13 149339 169638 156585.78 150986 166186 4756508 4756508 0.00
crit 9.15 23.14% 313229.52 298677 339276 313268.33 0 339276 2865051 2865051 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ede_crit
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 105.58sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.47 0.00 0.00 0.00 1.0421 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.65sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8408 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.04sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.19 0.00 0.00 0.00 0.5180 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.2 35.5sec 24.8sec 32.25% 32.25% 3.2(3.2) 7.9

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.5 1.4 27.3sec 23.7sec 34.70% 34.70% 1.4(1.4) 10.2

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.5 1.4 27.3sec 23.7sec 34.69% 34.69% 1.4(1.4) 10.2

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 28.1sec 23.5sec 33.68% 33.68% 1.8(1.8) 9.8

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.3 27.2 4.2sec 3.0sec 60.50% 63.54% 27.2(33.9) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:26.60%
  • elemental_focus_2:33.90%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.15% 19.15% 0.0(0.0) 4.7

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.2sec 32.2sec 21.28% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.63%
  • icefury_2:6.14%
  • icefury_3:5.18%
  • icefury_4:3.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 21.4 1.3 13.5sec 12.7sec 10.29% 38.57% 1.3(1.3) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.29%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.90% 29.90% 4.2(4.2) 12.6

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 94.3sec 0.0sec 39.91% 39.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.3 1.5 37.7sec 30.7sec 22.68% 25.49% 1.5(3.0) 0.1

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.45%
  • power_of_the_maelstrom_2:6.60%
  • power_of_the_maelstrom_3:9.64%

Trigger Attempt Success

  • trigger_pct:15.09%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 13.02% 9.64% 0.0(0.0) 0.3

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.59%
  • stormkeeper_2:3.83%
  • stormkeeper_3:4.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.0sec 100.00% 98.19% 2.2(2.2) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 22.7 12.7sec
Lava Surge: Wasted 1.3 77.1sec
Lava Surge: During Lava Burst 3.7 57.8sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7170.0014.8092.6230.0009.247
Fire Elemental0.5160.0011.5380.6000.0003.666
Lava Burst0.9300.0019.3007.5330.00026.472
Elemental Blast0.5550.0014.3589.3213.49819.129
Icefury1.0600.0017.8377.7810.33821.560

Resources

Resource Usage Type Count Total Average RPE APR
ede_crit
earth_shock Maelstrom 122.3 14682.1 120.1 946.9 2143.3
flame_shock Maelstrom 88.4 1577.5 17.9 140.7 24094.3
frost_shock Maelstrom 301.4 6028.1 20.0 157.7 6293.5
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 458.47 5441.93 (23.97%) 11.87 59.73 1.09%
Lava Burst Overload Maelstrom 292.61 2539.87 (11.19%) 8.68 93.59 3.55%
Lightning Bolt Maelstrom 701.99 5600.46 (24.67%) 7.98 15.46 0.28%
Lightning Bolt Overload Maelstrom 692.89 4106.32 (18.09%) 5.93 51.00 1.23%
Icefury Maelstrom 76.22 1818.99 (8.01%) 23.86 10.33 0.56%
Icefury Overload Maelstrom 48.69 865.83 (3.81%) 17.78 10.63 1.21%
Resonance Totem Maelstrom 2353.43 2330.25 (10.26%) 0.99 23.18 0.99%
Resource RPS-Gain RPS-Loss
Maelstrom 9.60 9.42
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 52.01 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ede_crit Fight Length
Count 7861
Mean 300.01
Minimum 239.99
Maximum 360.03
Spread ( max - min ) 120.04
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 35.8612
5th Percentile 245.63
95th Percentile 354.40
( 95th Percentile - 5th Percentile ) 108.77
Mean Distribution
Standard Deviation 0.4045
95.00% Confidence Intervall ( 299.21 - 300.80 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 549
0.1% Error 54890
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 44
0.01 Scale Factor Error with Delta=300 1098
DPS
Sample Data ede_crit Damage Per Second
Count 7861
Mean 1145014.30
Minimum 1001862.62
Maximum 1321572.02
Spread ( max - min ) 319709.39
Range [ ( max - min ) / 2 * 100% ] 13.96%
Standard Deviation 41405.5279
5th Percentile 1079149.45
95th Percentile 1216174.56
( 95th Percentile - 5th Percentile ) 137025.11
Mean Distribution
Standard Deviation 467.0027
95.00% Confidence Intervall ( 1144099.00 - 1145929.61 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5024
0.1 Scale Factor Error with Delta=300 14635256
0.05 Scale Factor Error with Delta=300 58541024
0.01 Scale Factor Error with Delta=300 1463525591
Priority Target DPS
Sample Data ede_crit Priority Target Damage Per Second
Count 7861
Mean 1145014.30
Minimum 1001862.62
Maximum 1321572.02
Spread ( max - min ) 319709.39
Range [ ( max - min ) / 2 * 100% ] 13.96%
Standard Deviation 41405.5279
5th Percentile 1079149.45
95th Percentile 1216174.56
( 95th Percentile - 5th Percentile ) 137025.11
Mean Distribution
Standard Deviation 467.0027
95.00% Confidence Intervall ( 1144099.00 - 1145929.61 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5024
0.1 Scale Factor Error with Delta=300 14635256
0.05 Scale Factor Error with Delta=300 58541024
0.01 Scale Factor Error with Delta=300 1463525591
DPS(e)
Sample Data ede_crit Damage Per Second (Effective)
Count 7861
Mean 1145014.30
Minimum 1001862.62
Maximum 1321572.02
Spread ( max - min ) 319709.39
Range [ ( max - min ) / 2 * 100% ] 13.96%
Damage
Sample Data ede_crit Damage
Count 7861
Mean 309589405.83
Minimum 225627531.08
Maximum 394360045.60
Spread ( max - min ) 168732514.51
Range [ ( max - min ) / 2 * 100% ] 27.25%
DTPS
Sample Data ede_crit Damage Taken Per Second
Count 7861
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ede_crit Healing Per Second
Count 7861
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ede_crit Healing Per Second (Effective)
Count 7861
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ede_crit Heal
Count 7861
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ede_crit Healing Taken Per Second
Count 7861
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ede_crit Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ede_critTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ede_crit Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.98 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.16 totem_mastery,if=buff.resonance_totem.remains<2
9 3.41 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 7.96 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.42 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.38 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 21.72 elemental_blast
Keep your EB always on Cooldown.
I 11.51 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.33 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.54 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.63 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 57.30 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.18 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.60 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 3.73 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 1.99 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 17.74 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 65.44 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNNSSOSSMHRRRPMSAMRMRRIHMMRRRKGNNMNOSHSSMSPSSSMHSSSJMMILKLHLMGMGNFNRMMMAHIMRRMS97SPSHKMNNNNMFMRHQRMMRSISAJMHMSSSSIKMNNFHMNNSASSMRRHRIMSSSSMKGHFNNMNSSMSPMHSJSSMSOSMSHIKMNNSMN9ANSHMMRMRRIMMOHMQSSKMGGNNHMSSSAIMJSSSHSMSOSMSMIKHMNANMMNNSSSHMOSSSMIMRRHMKMGMGNNR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.943 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.009 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:05.072 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:06.138 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:06.939 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:07.738 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:08.556 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:09.373 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.190 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.008 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.825 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:12.624 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:13.689 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:14.755 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:16.004 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.068 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:18.133 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.219 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.036 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.853 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.939 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.939 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.026 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.112 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.928 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.014 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.100 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.916 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom bloodlust, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.085 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.902 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.991 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.077 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.162 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.247 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:35.333 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:36.133 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:36.934 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:37.734 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:38.800 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.600 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:40.399 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:41.465 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:42.876 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:44.287 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:45.634 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:46.978 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.325 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.333 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.680 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.028 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.375 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.785 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:56.254 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:57.576 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:58.898 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:00.220 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.231 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.577 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.588 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.599 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.609 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.954 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:08.015 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:09.661 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:10.722 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:11.713 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:12.705 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:14.027 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:15.018 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:16.009 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:17.000 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:17.992 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:19.313 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.323 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.379 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.790 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.790 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.202 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.261 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.320 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.732 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.143 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:30.526 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:31.910 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:33.041 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:33.041 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:34.421 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:35.460 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:36.845 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:38.256 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:39.668 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, potion_of_prolonged_power
1:41.080 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:42.140 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:43.199 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:44.258 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:45.317 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:46.377 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:47.437 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:48.849 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:50.260 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.671 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:52.424 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:53.837 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.896 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.308 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.719 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.130 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.189 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.599 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.599 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.659 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.072 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.485 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.495 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.503 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.514 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.525 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.873 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.883 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.229 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:14.577 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
2:15.569 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
2:16.609 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
2:17.647 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
2:19.030 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
2:20.413 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
2:21.452 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:22.510 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:23.893 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:23.893 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:25.277 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:26.663 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:28.048 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:29.431 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:30.813 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:32.409 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:33.792 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.831 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:36.213 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:37.624 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:39.035 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:40.448 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:41.859 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:43.272 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:44.683 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity
2:45.742 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, extracted_sanity
2:47.152 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, extracted_sanity
2:48.210 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
2:49.220 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:50.230 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:51.577 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:52.587 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.933 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.279 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.290 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.637 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.698 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.110 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.524 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.936 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.974 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.013 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:06.051 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.435 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.474 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.514 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.897 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.936 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.320 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:14.925 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.933 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.280 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:18.627 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:19.637 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:20.648 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:21.969 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:23.289 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
3:24.280 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
3:25.273 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
3:25.273 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
3:26.311 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:27.723 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.135 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.148 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.495 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.841 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.852 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.199 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.545 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.556 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.566 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:39.914 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:40.974 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:42.542 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:43.602 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:44.356 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:45.768 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:47.180 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:48.688 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity
3:50.099 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:51.160 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:52.219 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:53.278 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:54.319 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:55.923 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:57.304 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:58.689 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.099 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.511 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.511 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.570 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.980 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:05.018 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:06.055 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:07.093 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:08.131 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.515 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.926 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.272 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.620 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.630 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.977 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:16.968 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:18.289 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:19.610 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:20.601 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:21.985 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:23.396 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:24.457 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:25.515 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:25.515 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:26.574 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:27.633 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:29.044 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:30.104 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
4:31.163 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.575 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:33.987 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:35.398 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:36.809 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:38.156 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:39.167 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:40.513 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:41.860 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:43.207 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:44.553 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:45.563 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:46.573 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:47.919 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:49.302 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:50.685 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:52.068 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:53.386 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
4:54.378 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
4:55.371 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
4:56.691 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:57.702 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:58.714 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
4:59.723 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ede_crit"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:7:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

edi_cl : 1109326 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1109326.4 1109326.4 886.9 / 0.080% 157000.8 / 14.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 52.7 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
edi_cl 1109326
Earth Shock 101861 9.2% 15.5 18.68sec 1973390 1971165 Direct 15.5 1374972 3807243 1973242 24.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.48 15.48 0.00 0.00 1.0012 0.0000 30543205.62 30543205.62 0.00 1971165.25 1971165.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.67 75.40% 1374971.94 1149885 1618024 1375426.43 1258506 1511932 16045415 16045415 0.00
crit 3.81 24.60% 3807242.94 3182882 4478691 3758218.31 0 4478691 14497790 14497790 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 62366 (95407) 5.6% (8.6%) 22.0 13.81sec 1299635 956506 Direct 22.0 594076 1644907 851671 24.5%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 21.96 0.00 0.00 1.3588 0.0000 18699615.47 18699615.47 0.00 956506.34 956506.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.58 75.49% 594075.58 528062 659824 594238.04 562663 625678 9847213 9847213 0.00
crit 5.38 24.51% 1644907.50 1461674 1826393 1641748.30 0 1826393 8852402 8852402 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33040 3.0% 13.9 21.22sec 713960 0 Direct 13.8 499032 1382399 715535 24.5%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.87 13.84 0.00 0.00 0.0000 0.0000 9901837.25 9901837.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.45 75.49% 499032.22 443572 554252 499194.84 460665 554252 5212819 5212819 0.00
crit 3.39 24.51% 1382398.75 1227806 1534170 1344502.23 0 1534170 4689019 4689019 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 120774 10.9% 11.2 27.79sec 3222015 3286848 Direct 11.2 88191 247449 209363 76.1%  
Periodic 226.4 48590 185231 149235 73.7% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 226.44 226.44 0.9803 1.3169 36142175.93 36142175.93 0.00 116895.36 3286847.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.68 23.91% 88190.72 78852 98528 86967.91 0 98528 236524 236524 0.00
crit 8.54 76.09% 247449.05 218264 272724 247500.28 229740 263147 2112052 2112052 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.6 26.34% 48589.93 136 54191 48586.86 44575 51171 2898127 2898127 0.00
crit 166.8 73.66% 185230.78 131 210001 185327.16 173376 195327 30895472 30895472 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 122874 11.1% 38.2 7.57sec 963172 979104 Direct 38.2 667052 1849480 963190 25.0%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.22 38.22 0.00 0.00 0.9837 0.0000 36810394.10 36810394.10 0.00 979104.00 979104.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.65 74.96% 667052.45 582433 746421 667371.43 631149 706280 19108959 19108959 0.00
crit 9.57 25.04% 1849479.61 1566784 2066092 1848959.86 1653511 2050038 17701435 17701435 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35535 (54471) 3.2% (4.9%) 9.7 32.24sec 1688457 1288434 Direct 9.6 756394 2095840 1103565 25.9%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.67 9.64 0.00 0.00 1.3106 0.0000 10642534.12 10642534.12 0.00 1288434.11 1288434.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.15 74.09% 756394.34 672025 839709 756609.46 672025 828835 5404550 5404550 0.00
crit 2.50 25.91% 2095840.15 1860166 2324315 1968194.35 0 2324315 5237984 5237984 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18936 1.7% 6.2 47.09sec 921682 0 Direct 6.1 635480 1760617 923722 25.6%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.16 6.15 0.00 0.00 0.0000 0.0000 5678060.76 5678060.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.57 74.39% 635480.29 564501 705356 634208.51 0 705356 2905816 2905816 0.00
crit 1.57 25.61% 1760617.23 1562539 1952425 1431240.11 0 1952425 2772245 2772245 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Insidious Corruption 14597 1.3% 5.1 60.44sec 857302 0 Periodic 48.0 73678 150279 91373 23.1% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.11 0.00 47.98 47.98 0.0000 1.2494 4384524.08 4384524.08 0.00 73131.47 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 76.90% 73678.49 109 76542 73671.99 69409 76542 2718732 2718732 0.00
crit 11.1 23.10% 150279.12 222 156146 150234.64 103505 156146 1665793 1665793 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 150250 (235947) 13.6% (21.3%) 58.0 5.12sec 1219007 1010422 Direct 57.9 0 778171 778171 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.03 57.89 0.00 0.00 1.2064 0.0000 45047044.62 45047044.62 0.00 1010421.95 1010421.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 57.89 100.00% 778171.32 701650 876726 778296.29 750184 806071 45047045 45047045 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77227 7.0% 36.9 8.02sec 626788 0 Direct 36.8 0 628681 628681 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.94 36.82 0.00 0.00 0.0000 0.0000 23150456.00 23150456.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 36.82 100.00% 628681.46 566884 708333 628769.63 601412 658915 23150456 23150456 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8471 0.8% 43.1 6.21sec 58913 0 Direct 43.1 46926 95741 58912 24.6%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.13 43.13 0.00 0.00 0.0000 0.0000 2541129.35 2541129.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.54 75.45% 46926.44 44808 50897 46942.06 45020 50358 1527102 1527102 0.00
crit 10.59 24.55% 95741.43 91408 103831 95735.01 0 103831 1014028 1014028 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 100480 (184975) 9.1% (16.7%) 89.2 3.27sec 621781 492954 Direct 89.2 237119 647639 337726 24.5%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.15 89.15 0.00 0.00 1.2613 0.0000 30109037.94 30109037.94 0.00 492953.77 492953.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.31 75.49% 237118.69 156284 585841 237313.63 199070 277422 15960184 15960184 0.00
crit 21.85 24.51% 647638.87 432595 1621608 647576.34 459837 993888 14148854 14148854 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 84495 7.6% 87.9 4.08sec 288163 0 Direct 87.9 202470 552631 288162 24.5%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.89 87.89 0.00 0.00 0.0000 0.0000 25325585.07 25325585.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.38 75.53% 202470.21 131279 492107 202502.67 159866 267138 13439663 13439663 0.00
crit 21.51 24.47% 552630.85 363380 1362151 552467.12 380818 1092427 11885922 11885922 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45584 (66644) 4.1% (6.0%) 3.0 120.39sec 6651890 0 Direct 94.2 116064 236771 143991 23.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 94.23 94.23 0.00 0.0000 0.6135 13568049.15 13568049.15 0.00 343173.07 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.43 76.86% 116064.33 116064 116064 116064.33 116064 116064 8406127 8406127 0.00
crit 21.80 23.14% 236771.23 236771 236771 236771.23 236771 236771 5161922 5161922 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21060 1.9% 37.5 7.02sec 167394 0 Direct 37.3 135409 276235 168074 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.46 37.30 0.00 0.00 0.0000 0.0000 6270099.96 6270099.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.65 76.80% 135409.19 135409 135409 135409.19 135409 135409 3879401 3879401 0.00
crit 8.65 23.20% 276234.76 276235 276235 276234.76 276235 276235 2390698 2390698 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 134493 / 86295
Fire Blast 134493 7.8% 97.0 3.01sec 265768 136920 Direct 97.0 213177 426408 265764 24.7%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.99 96.99 0.00 0.00 1.9411 0.0000 25775741.20 25775741.20 0.00 136920.02 136920.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.07 75.34% 213176.71 201607 229011 213228.54 207778 221082 15575850 15575850 0.00
crit 23.92 24.66% 426408.15 403214 458023 426503.00 411123 447651 10199891 10199891 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 179266 / 25481
Lightning Blast 179266 2.3% 39.5 7.14sec 192942 196287 Direct 39.5 156534 313183 192942 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.53 39.53 0.00 0.00 0.9830 0.0000 7626321.37 7626321.37 0.00 196286.55 196286.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.34 76.76% 156534.49 149339 169638 156574.10 151157 166343 4749157 4749157 0.00
crit 9.19 23.24% 313182.76 298677 339276 313242.48 298677 339276 2877164 2877164 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
edi_cl
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 105.84sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.47 0.00 0.00 0.00 1.0421 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.64sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 0.00 0.00 0.00 0.8405 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 112.94sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5184 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.24% 32.24% 3.1(3.1) 8.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.5 1.4 27.4sec 23.8sec 34.66% 34.66% 1.4(1.4) 10.2

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.1sec 23.6sec 34.91% 34.91% 1.4(1.4) 10.2

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.7 28.1sec 23.6sec 33.63% 33.63% 1.7(1.7) 9.8

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.2 27.1 4.2sec 3.0sec 60.41% 63.44% 27.1(33.7) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:26.62%
  • elemental_focus_2:33.79%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.16% 19.16% 0.0(0.0) 4.7

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.2sec 32.2sec 21.28% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.64%
  • icefury_2:6.13%
  • icefury_3:5.17%
  • icefury_4:3.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 21.3 1.3 13.5sec 12.8sec 10.19% 38.43% 1.3(1.3) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.19%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.92% 29.92% 4.2(4.2) 12.6

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 94.4sec 0.0sec 39.92% 39.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.2 1.5 37.7sec 30.8sec 22.51% 25.33% 1.5(3.0) 0.1

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.41%
  • power_of_the_maelstrom_2:6.56%
  • power_of_the_maelstrom_3:9.53%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 13.04% 9.62% 0.0(0.0) 0.3

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.58%
  • stormkeeper_2:3.87%
  • stormkeeper_3:4.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 112.9sec 100.00% 98.21% 2.2(2.2) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 22.6 12.8sec
Lava Surge: Wasted 1.3 80.3sec
Lava Surge: During Lava Burst 3.7 57.9sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7150.0014.5952.6170.00010.083
Fire Elemental0.5120.0011.5680.5970.0003.563
Lava Burst0.9340.0017.9987.5070.00029.266
Elemental Blast0.5530.0014.4739.2693.13517.886
Icefury1.0620.0018.7727.7770.47623.547

Resources

Resource Usage Type Count Total Average RPE APR
edi_cl
earth_shock Maelstrom 124.1 14906.1 120.1 963.1 2049.0
flame_shock Maelstrom 90.0 1604.5 17.8 143.0 22525.7
frost_shock Maelstrom 306.5 6129.8 20.0 160.4 6005.1
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 465.35 5524.06 (23.94%) 11.87 60.16 1.08%
Lava Burst Overload Maelstrom 296.20 2569.58 (11.14%) 8.68 96.26 3.61%
Lightning Bolt Maelstrom 714.99 5704.26 (24.72%) 7.98 15.64 0.27%
Lightning Bolt Overload Maelstrom 704.81 4176.91 (18.10%) 5.93 51.98 1.23%
Icefury Maelstrom 77.52 1849.84 (8.02%) 23.86 10.62 0.57%
Icefury Overload Maelstrom 49.41 878.25 (3.81%) 17.78 11.06 1.24%
Resonance Totem Maelstrom 2393.57 2370.25 (10.27%) 0.99 23.32 0.97%
Resource RPS-Gain RPS-Loss
Maelstrom 9.59 9.41
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 55.34 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data edi_cl Fight Length
Count 7811
Mean 300.01
Minimum 239.96
Maximum 360.03
Spread ( max - min ) 120.07
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 36.1105
5th Percentile 245.36
95th Percentile 354.62
( 95th Percentile - 5th Percentile ) 109.26
Mean Distribution
Standard Deviation 0.4086
95.00% Confidence Intervall ( 299.20 - 300.81 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 557
0.1% Error 55656
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1114
DPS
Sample Data edi_cl Damage Per Second
Count 7811
Mean 1109326.36
Minimum 976114.07
Maximum 1280378.82
Spread ( max - min ) 304264.74
Range [ ( max - min ) / 2 * 100% ] 13.71%
Standard Deviation 39991.9532
5th Percentile 1047197.51
95th Percentile 1178364.81
( 95th Percentile - 5th Percentile ) 131167.30
Mean Distribution
Standard Deviation 452.5007
95.00% Confidence Intervall ( 1108439.47 - 1110213.24 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4993
0.1 Scale Factor Error with Delta=300 13653026
0.05 Scale Factor Error with Delta=300 54612102
0.01 Scale Factor Error with Delta=300 1365302548
Priority Target DPS
Sample Data edi_cl Priority Target Damage Per Second
Count 7811
Mean 1109326.36
Minimum 976114.07
Maximum 1280378.82
Spread ( max - min ) 304264.74
Range [ ( max - min ) / 2 * 100% ] 13.71%
Standard Deviation 39991.9532
5th Percentile 1047197.51
95th Percentile 1178364.81
( 95th Percentile - 5th Percentile ) 131167.30
Mean Distribution
Standard Deviation 452.5007
95.00% Confidence Intervall ( 1108439.47 - 1110213.24 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4993
0.1 Scale Factor Error with Delta=300 13653026
0.05 Scale Factor Error with Delta=300 54612102
0.01 Scale Factor Error with Delta=300 1365302548
DPS(e)
Sample Data edi_cl Damage Per Second (Effective)
Count 7811
Mean 1109326.36
Minimum 976114.07
Maximum 1280378.82
Spread ( max - min ) 304264.74
Range [ ( max - min ) / 2 * 100% ] 13.71%
Damage
Sample Data edi_cl Damage
Count 7811
Mean 298813749.42
Minimum 213395908.89
Maximum 381511883.05
Spread ( max - min ) 168115974.16
Range [ ( max - min ) / 2 * 100% ] 28.13%
DTPS
Sample Data edi_cl Damage Taken Per Second
Count 7811
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data edi_cl Healing Per Second
Count 7811
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data edi_cl Healing Per Second (Effective)
Count 7811
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data edi_cl Heal
Count 7811
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data edi_cl Healing Taken Per Second
Count 7811
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data edi_cl Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data edi_clTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data edi_cl Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.98 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.16 totem_mastery,if=buff.resonance_totem.remains<2
9 3.39 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 7.91 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.37 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.23 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 21.58 elemental_blast
Keep your EB always on Cooldown.
I 11.41 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.30 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.48 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.62 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 56.83 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.08 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.58 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 3.70 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 1.98 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 17.50 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 65.26 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNSNMNSSOSMHSSSSSAMISSSSSHMSISSKNNSMNNRHROMMRSSMIMHMRRJLMPSKNNHMNSNSFSMMARHRRPMMSSSSM97HIKMMFNNNSMHNQSSSMSAJSIHMLLMOKNMMGNHNRAMMISSSMSHSMOMSISKNNHMNNRRMRSMPHMJMSOSSSMSSHIKM9MMANNNNMHSSSSMMISSSHFMQSKNMNNNSHSMMAPRJLLMMMHISFSMSSKNAMHMMGGNRROMPRHSSMSSSSSIHKMNNMNM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.876 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.941 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:03.956 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.973 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.990 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.754 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.516 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:08.297 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:09.076 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, lava_surge, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.854 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.632 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.411 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.190 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.967 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.053 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.139 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.225 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.261 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.297 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:19.313 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.328 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.344 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.344 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.360 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:23.123 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:24.139 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:25.156 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:26.173 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:27.188 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:28.253 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:29.318 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:30.335 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:31.351 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.131 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.168 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.205 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:35.242 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, potion_of_prolonged_power
0:36.022 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
0:36.802 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, potion_of_prolonged_power
0:37.839 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:38.875 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:39.652 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:40.470 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:41.556 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:42.940 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:44.323 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:45.315 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:46.635 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:47.627 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.973 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.320 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.665 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.677 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.688 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:55.072 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:56.455 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:57.445 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:58.765 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:00.086 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.095 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.106 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.426 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.419 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:05.412 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:06.733 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:07.773 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:08.831 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:10.243 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:11.655 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:12.713 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:13.773 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:14.833 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.244 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.304 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.716 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.775 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.187 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:21.187 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:22.571 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:23.954 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:25.275 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:26.594 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:27.586 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:28.934 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:29.946 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:31.293 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:32.640 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:33.987 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:35.399 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
1:36.810 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
1:37.871 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
1:37.871 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:39.282 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:40.341 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:41.754 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:42.813 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:44.224 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:45.284 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
1:46.343 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
1:47.382 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
1:48.419 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
1:49.802 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
1:51.185 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
1:52.661 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:53.719 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.474 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.886 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.298 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.708 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.119 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.530 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.530 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.591 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.651 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.711 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.121 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:07.504 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:08.542 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:09.580 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:10.619 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:11.658 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.159 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:14.219 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:15.631 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:16.692 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:17.752 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:18.812 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:20.224 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:21.284 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.696 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.696 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.106 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:25.145 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:26.184 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:27.568 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:28.951 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:30.335 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.745 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:33.155 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:34.565 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:35.976 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:36.987 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:37.998 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:39.345 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:40.665 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:41.653 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:42.974 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:44.476 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:45.468 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, extracted_sanity
2:46.527 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, extracted_sanity
2:47.973 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:49.385 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:50.443 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:51.503 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.916 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.300 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:55.684 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.066 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.450 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.507 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.567 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.979 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.970 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.961 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.281 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:06.274 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:07.265 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:08.256 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:09.247 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:10.570 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:11.891 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:13.209 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.620 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:16.031 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.040 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.387 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:19.397 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:20.407 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:21.754 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:22.766 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:22.766 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:23.775 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
3:24.784 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
3:25.795 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
3:26.807 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:28.190 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:29.574 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:30.894 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.214 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.561 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.905 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:36.253 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:37.264 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.273 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:39.620 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:41.033 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:42.444 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:43.855 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:44.866 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:46.211 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:46.965 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.312 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.729 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:50.721 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:52.042 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:53.033 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:54.025 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:55.066 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:56.450 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.864 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:59.275 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.284 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.632 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.632 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.642 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.988 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:04.979 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:05.971 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:06.962 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:07.954 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:09.274 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.333 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.745 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.803 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.814 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.825 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.171 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.516 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.862 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.208 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.553 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:22.564 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:22.564 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:23.623 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:25.151 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:26.161 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:27.508 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
4:28.499 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
4:29.491 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
4:30.482 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:31.803 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:33.122 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:34.112 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:35.432 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:36.470 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:37.855 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:39.238 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:40.652 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:41.998 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:43.343 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:44.690 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:46.037 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:47.383 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.729 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.076 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.135 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.646 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.994 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:55.341 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:56.351 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:57.363 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:58.709 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:59.719 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="edi_cl"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:7:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

fs_fs : 1132682 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1132681.9 1132681.9 905.6 / 0.080% 156718.3 / 13.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 52.7 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
fs_fs 1132682
Earth Shock 102282 9.0% 15.5 18.62sec 1979091 1976857 Direct 15.5 1375047 3804251 1979076 24.9%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.50 15.50 0.00 0.00 1.0012 0.0000 30676861.61 30676861.61 0.00 1976856.66 1976856.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.65 75.13% 1375046.65 1149885 1618024 1375494.64 1250952 1494310 16013542 16013542 0.00
crit 3.85 24.87% 3804251.05 3182882 4478691 3758180.68 0 4478691 14663320 14663320 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 62443 (95372) 5.5% (8.4%) 22.0 13.81sec 1299644 956540 Direct 22.0 594157 1645174 852780 24.6%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 21.96 0.00 0.00 1.3587 0.0000 18721854.48 18721854.48 0.00 956539.76 956539.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.55 75.40% 594157.19 528062 659824 594317.28 558221 628506 9835573 9835573 0.00
crit 5.40 24.60% 1645174.06 1461674 1826393 1641465.28 0 1826393 8886281 8886281 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 32929 2.9% 13.9 21.14sec 710057 0 Direct 13.9 499143 1382022 711581 24.1%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.91 13.88 0.00 0.00 0.0000 0.0000 9875814.87 9875814.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.54 75.94% 499143.46 443572 554252 499257.47 459555 554252 5260813 5260813 0.00
crit 3.34 24.06% 1382022.16 1227806 1534170 1339986.55 0 1534170 4615002 4615002 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 142791 12.6% 11.2 27.76sec 3810962 3888181 Direct 11.2 104237 292468 247098 75.9%  
Periodic 226.4 57403 218908 176497 73.7% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 226.44 226.44 0.9802 1.3168 42738890.76 42738890.76 0.00 138236.17 3888181.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.70 24.10% 104236.78 93189 116442 103026.89 0 116442 281698 281698 0.00
crit 8.51 75.90% 292468.13 257948 322310 292526.58 275020 308767 2489561 2489561 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.5 26.26% 57403.40 126 64044 57391.46 52359 61017 3413006 3413006 0.00
crit 167.0 73.74% 218907.92 116 248183 219017.10 206111 229570 36554625 36554625 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123344 10.9% 38.2 7.57sec 967127 983041 Direct 38.2 667060 1849201 967103 25.4%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.22 38.22 0.00 0.00 0.9838 0.0000 36964310.57 36964310.57 0.00 983041.08 983041.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.52 74.62% 667059.57 576950 746421 667360.12 632798 710059 19024152 19024152 0.00
crit 9.70 25.38% 1849200.68 1653511 2066092 1848955.30 1653511 2066092 17940158 17940158 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35376 (54466) 3.1% (4.8%) 9.7 32.23sec 1688423 1288131 Direct 9.6 756409 2095887 1099243 25.6%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.66 9.64 0.00 0.00 1.3108 0.0000 10600672.21 10600672.21 0.00 1288131.01 1288131.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.17 74.40% 756409.49 672025 839709 756693.13 685466 823397 5427210 5427210 0.00
crit 2.47 25.60% 2095887.16 1860166 2324315 1971149.00 0 2324315 5173462 5173462 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 19091 1.7% 6.2 46.47sec 922771 0 Direct 6.2 635276 1762724 924551 25.7%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.20 6.18 0.00 0.00 0.0000 0.0000 5717371.44 5717371.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.60 74.34% 635275.73 564501 705356 633684.89 0 705356 2920215 2920215 0.00
crit 1.59 25.66% 1762723.95 1562539 1952425 1447905.99 0 1952425 2797157 2797157 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Insidious Corruption 14591 1.3% 5.1 60.45sec 856138 0 Periodic 48.0 73695 150258 91336 23.0% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 0.00 47.98 47.98 0.0000 1.2495 4382315.76 4382315.76 0.00 73098.29 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 76.96% 73694.72 109 76542 73686.55 70102 76542 2720996 2720996 0.00
crit 11.1 23.04% 150258.20 222 156146 150268.81 113829 156146 1661320 1661320 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 150454 (236197) 13.3% (20.9%) 58.1 5.11sec 1218670 1010438 Direct 58.0 0 778206 778206 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.12 57.97 0.00 0.00 1.2061 0.0000 45115237.73 45115237.73 0.00 1010438.32 1010438.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 57.97 100.00% 778205.98 701650 876726 778307.56 754522 805452 45115238 45115238 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77220 6.8% 36.9 7.99sec 626819 0 Direct 36.8 0 628764 628764 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.95 36.83 0.00 0.00 0.0000 0.0000 23158809.61 23158809.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 36.83 100.00% 628764.10 566884 708333 628864.35 604048 661795 23158810 23158810 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8523 0.8% 43.3 6.28sec 59010 0 Direct 43.3 46927 95752 59011 24.7%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.31 43.31 0.00 0.00 0.0000 0.0000 2555658.20 2555658.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.59 75.25% 46927.01 44808 50897 46940.64 45071 49295 1529388 1529388 0.00
crit 10.72 24.75% 95752.41 91408 103831 95727.74 0 103831 1026270 1026270 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 100467 (185123) 8.9% (16.4%) 89.1 3.27sec 622853 493840 Direct 89.1 237271 647858 337990 24.5%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.08 89.08 0.00 0.00 1.2613 0.0000 30106716.24 30106716.24 0.00 493839.53 493839.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.23 75.47% 237271.04 156284 585841 237477.65 197661 275648 15951269 15951269 0.00
crit 21.85 24.53% 647858.11 432595 1621608 647948.86 468176 991677 14155448 14155448 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 84656 7.5% 88.0 4.08sec 288420 0 Direct 88.0 202609 552693 288429 24.5%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.98 87.98 0.00 0.00 0.0000 0.0000 25374673.64 25374673.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.41 75.49% 202608.87 131279 492107 202651.29 163437 259353 13455894 13455894 0.00
crit 21.57 24.51% 552692.81 363380 1362151 552949.38 395141 851345 11918780 11918780 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45560 (66673) 4.0% (5.9%) 3.0 120.39sec 6651217 0 Direct 94.2 116064 236771 143939 23.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 94.22 94.22 0.00 0.0000 0.6136 13561730.31 13561730.31 0.00 343337.91 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.47 76.91% 116064.33 116064 116064 116064.33 116064 116064 8410978 8410978 0.00
crit 21.75 23.09% 236771.23 236771 236771 236771.23 236771 236771 5150753 5150753 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21114 1.9% 37.5 7.02sec 167485 0 Direct 37.4 135409 276235 168103 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.55 37.41 0.00 0.00 0.0000 0.0000 6288351.21 6288351.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.72 76.78% 135409.19 135409 135409 135409.19 135409 135409 3889135 3889135 0.00
crit 8.69 23.22% 276234.76 276235 276235 276159.29 0 276235 2399216 2399216 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 134433 / 86329
Fire Blast 134433 7.6% 97.1 3.00sec 265633 136843 Direct 97.1 213188 426361 265638 24.6%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.09 97.09 0.00 0.00 1.9412 0.0000 25791119.02 25791119.02 0.00 136843.24 136843.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.21 75.40% 213187.55 201607 229011 213239.61 207898 220428 15606621 15606621 0.00
crit 23.89 24.60% 426361.17 403214 458023 426482.52 411044 445685 10184498 10184498 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 179401 / 25513
Lightning Blast 179401 2.3% 39.6 7.15sec 193091 196446 Direct 39.6 156651 313321 193096 23.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.56 39.56 0.00 0.00 0.9829 0.0000 7638009.86 7638009.86 0.00 196445.82 196445.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.36 76.74% 156650.79 149339 169638 156687.28 150920 166642 4755359 4755359 0.00
crit 9.20 23.26% 313321.21 298677 339276 313334.09 0 339276 2882651 2882651 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
fs_fs
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 105.73sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.47 0.00 0.00 0.00 1.0420 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.64sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8406 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 112.90sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5184 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.17% 32.17% 3.1(3.1) 7.9

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.5 1.4 27.3sec 23.7sec 34.74% 34.74% 1.4(1.4) 10.2

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.5 27.2sec 23.6sec 34.85% 34.85% 1.5(1.5) 10.2

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.7 28.2sec 23.7sec 33.60% 33.60% 1.7(1.7) 9.8

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.3 27.2 4.2sec 3.0sec 60.51% 63.53% 27.2(33.9) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:26.63%
  • elemental_focus_2:33.88%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.14% 19.14% 0.0(0.0) 4.7

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.2sec 32.2sec 21.30% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.65%
  • icefury_2:6.15%
  • icefury_3:5.16%
  • icefury_4:3.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 21.4 1.3 13.5sec 12.7sec 10.26% 38.53% 1.3(1.3) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.26%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 13.0 4.2 23.0sec 17.1sec 29.98% 29.98% 4.2(4.2) 12.7

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 94.4sec 0.0sec 39.91% 39.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.3 1.4 37.6sec 30.8sec 22.67% 25.51% 1.4(3.0) 0.1

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.44%
  • power_of_the_maelstrom_2:6.59%
  • power_of_the_maelstrom_3:9.64%

Trigger Attempt Success

  • trigger_pct:15.05%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 13.04% 9.64% 0.0(0.0) 0.3

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.57%
  • stormkeeper_2:3.87%
  • stormkeeper_3:4.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 112.9sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 22.7 12.7sec
Lava Surge: Wasted 1.3 79.8sec
Lava Surge: During Lava Burst 3.7 58.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7120.0014.6022.6050.0009.085
Fire Elemental0.5090.0011.5330.5890.0003.974
Lava Burst0.9340.0018.4617.5180.00026.670
Elemental Blast0.5540.0015.1059.2912.92618.108
Icefury1.0600.0018.7537.7550.54723.719

Resources

Resource Usage Type Count Total Average RPE APR
fs_fs
earth_shock Maelstrom 122.8 14747.1 120.1 951.4 2080.2
flame_shock Maelstrom 88.9 1585.0 17.8 141.3 26965.0
frost_shock Maelstrom 302.8 6056.9 20.0 158.5 6102.9
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 460.51 5467.41 (23.97%) 11.87 58.67 1.06%
Lava Burst Overload Maelstrom 292.74 2540.84 (11.14%) 8.68 93.78 3.56%
Lightning Bolt Maelstrom 705.76 5630.81 (24.68%) 7.98 15.29 0.27%
Lightning Bolt Overload Maelstrom 697.05 4131.60 (18.11%) 5.93 50.72 1.21%
Icefury Maelstrom 76.58 1827.00 (8.01%) 23.86 10.88 0.59%
Icefury Overload Maelstrom 49.09 872.78 (3.83%) 17.78 10.87 1.23%
Resonance Totem Maelstrom 2364.89 2341.75 (10.27%) 0.99 23.14 0.98%
Resource RPS-Gain RPS-Loss
Maelstrom 9.60 9.42
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 53.79 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data fs_fs Fight Length
Count 7321
Mean 300.01
Minimum 240.00
Maximum 360.01
Spread ( max - min ) 120.01
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 35.9523
5th Percentile 245.83
95th Percentile 354.21
( 95th Percentile - 5th Percentile ) 108.38
Mean Distribution
Standard Deviation 0.4202
95.00% Confidence Intervall ( 299.18 - 300.83 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 552
0.1% Error 55169
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1104
DPS
Sample Data fs_fs Damage Per Second
Count 7321
Mean 1132681.88
Minimum 990274.79
Maximum 1281027.06
Spread ( max - min ) 290752.27
Range [ ( max - min ) / 2 * 100% ] 12.83%
Standard Deviation 39532.8941
5th Percentile 1069500.05
95th Percentile 1198708.27
( 95th Percentile - 5th Percentile ) 129208.22
Mean Distribution
Standard Deviation 462.0334
95.00% Confidence Intervall ( 1131776.31 - 1133587.45 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4680
0.1 Scale Factor Error with Delta=300 13341385
0.05 Scale Factor Error with Delta=300 53365537
0.01 Scale Factor Error with Delta=300 1334138405
Priority Target DPS
Sample Data fs_fs Priority Target Damage Per Second
Count 7321
Mean 1132681.88
Minimum 990274.79
Maximum 1281027.06
Spread ( max - min ) 290752.27
Range [ ( max - min ) / 2 * 100% ] 12.83%
Standard Deviation 39532.8941
5th Percentile 1069500.05
95th Percentile 1198708.27
( 95th Percentile - 5th Percentile ) 129208.22
Mean Distribution
Standard Deviation 462.0334
95.00% Confidence Intervall ( 1131776.31 - 1133587.45 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4680
0.1 Scale Factor Error with Delta=300 13341385
0.05 Scale Factor Error with Delta=300 53365537
0.01 Scale Factor Error with Delta=300 1334138405
DPS(e)
Sample Data fs_fs Damage Per Second (Effective)
Count 7321
Mean 1132681.88
Minimum 990274.79
Maximum 1281027.06
Spread ( max - min ) 290752.27
Range [ ( max - min ) / 2 * 100% ] 12.83%
Damage
Sample Data fs_fs Damage
Count 7321
Mean 305839268.65
Minimum 225173082.10
Maximum 400133987.01
Spread ( max - min ) 174960904.91
Range [ ( max - min ) / 2 * 100% ] 28.60%
DTPS
Sample Data fs_fs Damage Taken Per Second
Count 7321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data fs_fs Healing Per Second
Count 7321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data fs_fs Healing Per Second (Effective)
Count 7321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data fs_fs Heal
Count 7321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data fs_fs Healing Taken Per Second
Count 7321
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data fs_fs Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data fs_fsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data fs_fs Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.92 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.15 totem_mastery,if=buff.resonance_totem.remains<2
9 3.17 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 7.42 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.12 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 5.94 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 20.23 elemental_blast
Keep your EB always on Cooldown.
I 10.71 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.03 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 8.89 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.34 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 53.35 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 29.04 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.14 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 3.48 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 1.86 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 16.52 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 60.97 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNSNSOSSMMHSSSSIAMMSSSMSPHMMSSKNNNNMMORHRRMSSISSMHSSJSMMLIKLMHMNNNFMMNRARHRMIMR97RRMSHIKNMMNFSSNHMMNQSSSAJMMHMISSMKMGNFNHMMANSSSSIMSHSSMSOSSKGGHMGMGSSISMSHJSSMSOSSSIMHKNNNMANS9SSHMMSSSSIMOSHSSMKMGNNN8MHMRRAIJLMSOSHSMMPSSSKMAHNNNNSMSSSSHMISOSSMRRRHIKMNNNS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:02.964 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:04.001 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:05.037 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:06.073 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:06.851 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:07.630 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:08.407 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.185 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.963 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.744 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.522 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.301 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.339 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.426 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.241 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.327 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.364 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.401 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.437 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.473 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.251 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.251 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.286 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.065 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.102 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.140 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.156 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.919 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.985 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.784 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.852 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.652 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.718 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.785 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.850 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:35.062 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:35.861 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
0:36.677 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, potion_of_prolonged_power
0:37.495 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, extracted_sanity, potion_of_prolonged_power
0:38.311 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:39.127 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:40.211 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:41.029 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:42.440 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:43.852 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:45.264 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:46.675 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.086 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.499 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.910 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.968 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.380 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.793 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.205 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.617 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:59.032 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.378 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.389 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.399 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.408 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.754 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.765 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.774 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.122 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:09.182 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:10.241 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:11.654 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:13.066 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:14.105 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:15.143 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:16.183 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:17.219 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:18.258 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:19.641 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:20.699 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.109 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.109 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.520 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.060 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.471 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:27.530 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:28.590 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:29.975 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:31.358 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:32.395 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:32.395 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:33.779 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:35.162 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:36.546 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:37.959 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:39.371 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:40.430 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:41.841 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, potion_of_prolonged_power
1:42.901 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
1:44.312 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
1:45.370 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
1:46.430 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
1:47.489 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
1:48.902 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
1:50.313 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
1:51.373 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
1:52.783 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
1:53.842 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.252 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.312 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.066 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:58.476 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.891 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.302 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.302 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.443 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.503 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:04.913 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.324 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.383 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.442 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.502 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.561 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.974 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:13.360 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
2:14.397 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
2:15.434 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
2:16.473 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
2:17.510 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
2:18.548 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:19.962 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:21.024 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:22.435 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:22.435 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:23.495 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.907 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:26.320 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.731 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:29.142 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:30.201 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.611 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:33.022 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:34.432 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:35.846 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:37.257 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:38.668 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:40.078 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:41.137 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:42.547 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:43.960 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:45.372 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity
2:46.433 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:47.471 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
2:48.854 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:49.846 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:50.836 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
2:52.156 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
2:53.147 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:54.468 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:55.788 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:56.782 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:58.104 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:59.425 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:00.808 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.262 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.448 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.459 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.469 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.815 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.825 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.837 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.183 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.503 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.825 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.863 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:15.246 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:16.629 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:17.950 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:18.941 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:19.934 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:20.923 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:22.269 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:22.269 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:23.280 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.628 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.638 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.986 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.397 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.039 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.097 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.508 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.919 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.330 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:36.741 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.151 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:39.210 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:40.622 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:41.681 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:43.093 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:44.506 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:45.919 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:47.266 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:48.276 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:49.623 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
3:50.944 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
3:51.935 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
3:52.926 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
3:53.918 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:54.910 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.664 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.724 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.136 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.548 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.956 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.368 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.368 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.429 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.505 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.564 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.977 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.037 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.097 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.156 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.570 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.981 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.040 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.452 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.512 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.925 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.337 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.749 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.160 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:23.542 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:23.542 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:24.947 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:25.940 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
4:26.933 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
4:27.924 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
4:28.915 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.260 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:31.582 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:32.903 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:34.224 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:35.544 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:36.928 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:38.325 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:39.708 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:40.720 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:42.067 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:43.076 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:44.424 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:45.744 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:47.065 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:48.385 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:49.706 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:51.089 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:52.474 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:53.465 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.811 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:56.157 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:57.169 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:58.178 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:59.189 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="fs_fs"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:7:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

li_lvb : 1128517 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1128516.9 1128516.9 902.4 / 0.080% 156795.5 / 13.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 52.7 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
li_lvb 1128517
Earth Shock 101782 9.0% 15.5 18.65sec 1972210 1970090 Direct 15.5 1374994 3806739 1972179 24.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.48 15.48 0.00 0.00 1.0011 0.0000 30526540.66 30526540.66 0.00 1970089.75 1970089.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.68 75.44% 1374994.23 1149885 1618024 1375381.09 1255847 1503368 16055804 16055804 0.00
crit 3.80 24.56% 3806739.38 3182882 4478691 3751869.97 0 4478691 14470736 14470736 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 62392 (95392) 5.5% (8.5%) 22.0 13.81sec 1299925 956749 Direct 22.0 594177 1644531 852084 24.6%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 21.96 0.00 0.00 1.3587 0.0000 18708455.31 18708455.31 0.00 956749.13 956749.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.57 75.45% 594176.74 528062 659824 594352.81 564206 628506 9842627 9842627 0.00
crit 5.39 24.55% 1644530.91 1461674 1826393 1641650.68 0 1826393 8865828 8865828 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33001 2.9% 13.9 21.13sec 711479 0 Direct 13.9 499082 1381784 713263 24.3%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.91 13.87 0.00 0.00 0.0000 0.0000 9895473.53 9895473.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.51 75.74% 499082.30 443572 554252 499273.05 460044 543485 5244394 5244394 0.00
crit 3.37 24.26% 1381784.09 1227806 1534170 1342771.32 0 1534170 4651080 4651080 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 120793 10.7% 11.2 27.80sec 3224052 3287871 Direct 11.2 88063 247455 209109 75.9%  
Periodic 226.4 48554 185269 149298 73.7% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 226.42 226.42 0.9807 1.3169 36150140.40 36150140.40 0.00 116926.04 3287870.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.70 24.05% 88062.80 78852 98528 86964.31 0 98528 237523 237523 0.00
crit 8.52 75.95% 247455.02 218264 272724 247508.63 232616 263293 2107217 2107217 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.6 26.31% 48553.54 178 54191 48547.04 44323 51199 2892288 2892288 0.00
crit 166.9 73.69% 185268.95 131 210001 185363.63 173691 193942 30913113 30913113 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123352 10.9% 38.2 7.57sec 966930 982822 Direct 38.2 667121 1849283 967006 25.4%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.22 38.22 0.00 0.00 0.9838 0.0000 36959024.06 36959024.06 0.00 982822.07 982822.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.53 74.64% 667121.38 582433 746421 667430.86 634708 712087 19032354 19032354 0.00
crit 9.69 25.36% 1849282.77 1653511 2066092 1848619.12 1653511 2022546 17926670 17926670 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35523 (54645) 3.1% (4.8%) 9.7 32.23sec 1694254 1292634 Direct 9.6 756597 2097176 1103900 25.9%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.66 9.64 0.00 0.00 1.3107 0.0000 10642746.11 10642746.11 0.00 1292633.57 1292633.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.14 74.09% 756596.91 672025 839709 756889.12 687447 828835 5404342 5404342 0.00
crit 2.50 25.91% 2097176.10 1860166 2324315 1972712.37 0 2324315 5238404 5238404 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 19122 1.7% 6.2 47.42sec 927867 0 Direct 6.2 635914 1761122 929637 26.1%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.18 6.16 0.00 0.00 0.0000 0.0000 5729750.71 5729750.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.56 73.90% 635914.21 564501 705356 634389.65 0 705356 2896651 2896651 0.00
crit 1.61 26.10% 1761122.23 1562539 1952425 1450475.36 0 1952425 2833100 2833100 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Insidious Corruption 14597 1.3% 5.1 60.44sec 856209 0 Periodic 48.0 73706 150112 91358 23.1% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 0.00 47.98 47.98 0.0000 1.2495 4383270.26 4383270.26 0.00 73114.21 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 76.90% 73706.36 109 76542 73699.37 69372 76542 2719367 2719367 0.00
crit 11.1 23.10% 150112.45 222 156146 150100.66 107425 156146 1663903 1663903 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 162424 (254494) 14.4% (22.6%) 58.1 5.11sec 1314057 1089399 Direct 57.9 0 840735 840735 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.07 57.93 0.00 0.00 1.2062 0.0000 48701757.13 48701757.13 0.00 1089398.94 1089398.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 57.93 100.00% 840735.22 758033 947177 840864.81 810836 872086 48701757 48701757 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 83631 7.4% 37.0 7.96sec 677196 0 Direct 36.9 0 679280 679280 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.03 36.91 0.00 0.00 0.0000 0.0000 25073702.23 25073702.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 36.91 100.00% 679279.78 612437 765252 679377.99 651060 710482 25073702 25073702 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8440 0.7% 42.9 6.30sec 58959 0 Direct 42.9 46930 95773 58960 24.6%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.92 42.92 0.00 0.00 0.0000 0.0000 2530400.16 2530400.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.35 75.37% 46930.43 44808 50897 46946.09 45027 50897 1518103 1518103 0.00
crit 10.57 24.63% 95772.55 91408 103831 95761.26 0 103831 1012298 1012298 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 100571 (184907) 8.9% (16.4%) 89.1 3.27sec 621944 493081 Direct 89.1 237170 648240 338232 24.6%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.10 89.10 0.00 0.00 1.2613 0.0000 30136430.35 30136430.35 0.00 493080.91 493080.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.20 75.42% 237169.64 156284 585841 237362.10 200666 278241 15938022 15938022 0.00
crit 21.90 24.58% 648239.69 432595 1621608 648287.96 459232 958628 14198408 14198408 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 84335 7.5% 87.8 4.10sec 288053 0 Direct 87.8 202476 551760 288043 24.5%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.76 87.76 0.00 0.00 0.0000 0.0000 25279946.63 25279946.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.26 75.50% 202476.48 131279 492107 202485.82 159209 253583 13417308 13417308 0.00
crit 21.50 24.50% 551760.07 363380 1362151 551486.10 388782 880193 11862638 11862638 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45568 (66695) 4.0% (5.9%) 3.0 120.39sec 6652458 0 Direct 94.2 116064 236771 143967 23.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 94.20 94.20 0.00 0.0000 0.6138 13562276.52 13562276.52 0.00 343344.22 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.43 76.89% 116064.33 116064 116064 116064.33 116064 116064 8406490 8406490 0.00
crit 21.78 23.11% 236771.23 236771 236771 236771.23 236771 236771 5155787 5155787 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21126 1.9% 37.6 6.99sec 167433 0 Direct 37.4 135409 276235 168099 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.56 37.42 0.00 0.00 0.0000 0.0000 6289542.76 6289542.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.73 76.79% 135409.19 135409 135409 135409.19 135409 135409 3890694 3890694 0.00
crit 8.68 23.21% 276234.76 276235 276235 276198.83 0 276235 2398849 2398849 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 134493 / 86347
Fire Blast 134493 7.6% 97.0 3.00sec 265791 136912 Direct 97.0 213208 426359 265796 24.7%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.04 97.04 0.00 0.00 1.9413 0.0000 25793021.82 25793021.82 0.00 136912.18 136912.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.10 75.33% 213208.19 201607 229011 213261.78 207778 221791 15586229 15586229 0.00
crit 23.94 24.67% 426359.04 403214 458023 426454.73 410332 448983 10206792 10206792 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 179314 / 25512
Lightning Blast 179314 2.3% 39.6 7.14sec 193000 196316 Direct 39.6 156560 313141 193001 23.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.57 39.57 0.00 0.00 0.9831 0.0000 7636881.78 7636881.78 0.00 196315.82 196315.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.36 76.73% 156559.72 149339 169638 156594.69 151033 166942 4753188 4753188 0.00
crit 9.21 23.27% 313140.53 298677 339276 313125.38 0 339276 2883693 2883693 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
li_lvb
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 105.58sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.47 0.00 0.00 0.00 1.0422 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.64sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8406 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 112.91sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5185 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.0sec 32.15% 32.15% 3.1(3.1) 7.9

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.5 1.4 27.4sec 23.9sec 34.60% 34.60% 1.4(1.4) 10.1

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.5 1.4 27.2sec 23.6sec 34.76% 34.76% 1.4(1.4) 10.2

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 28.0sec 23.6sec 33.85% 33.85% 1.8(1.8) 9.9

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.3 27.3 4.2sec 3.0sec 60.45% 63.49% 27.3(33.9) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:26.57%
  • elemental_focus_2:33.87%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.13% 19.13% 0.0(0.0) 4.7

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.2sec 32.2sec 21.26% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.62%
  • icefury_2:6.15%
  • icefury_3:5.18%
  • icefury_4:3.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 21.4 1.3 13.5sec 12.7sec 10.25% 38.47% 1.3(1.3) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.25%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.0 4.2 23.0sec 17.1sec 29.96% 29.96% 4.2(4.2) 12.7

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 94.3sec 0.0sec 39.92% 39.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.2 1.5 37.8sec 30.8sec 22.49% 25.23% 1.5(3.0) 0.1

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.39%
  • power_of_the_maelstrom_2:6.56%
  • power_of_the_maelstrom_3:9.54%

Trigger Attempt Success

  • trigger_pct:14.93%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 13.09% 9.63% 0.0(0.0) 0.3

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.58%
  • stormkeeper_2:3.89%
  • stormkeeper_3:4.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 112.9sec 100.00% 98.19% 2.2(2.2) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 22.6 12.7sec
Lava Surge: Wasted 1.3 79.5sec
Lava Surge: During Lava Burst 3.7 57.6sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7150.0015.3402.6060.0009.083
Fire Elemental0.5110.0011.5650.5900.0003.243
Lava Burst0.9360.0018.7587.5640.00023.849
Elemental Blast0.5530.0015.3409.2773.23618.067
Icefury1.0570.0018.1847.7430.47123.989

Resources

Resource Usage Type Count Total Average RPE APR
li_lvb
earth_shock Maelstrom 119.1 14305.3 120.1 924.2 2133.9
flame_shock Maelstrom 86.3 1541.1 17.9 137.4 23457.4
frost_shock Maelstrom 294.2 5884.1 20.0 153.9 6281.1
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 446.95 5304.84 (23.95%) 11.87 58.51 1.09%
Lava Burst Overload Maelstrom 284.96 2472.17 (11.16%) 8.68 92.48 3.61%
Lightning Bolt Maelstrom 685.82 5471.74 (24.71%) 7.98 14.85 0.27%
Lightning Bolt Overload Maelstrom 675.50 4003.67 (18.08%) 5.93 49.31 1.22%
Icefury Maelstrom 74.38 1774.58 (8.01%) 23.86 10.62 0.59%
Icefury Overload Maelstrom 47.53 845.63 (3.82%) 17.79 9.96 1.16%
Resonance Totem Maelstrom 2297.18 2274.66 (10.27%) 0.99 22.53 0.98%
Resource RPS-Gain RPS-Loss
Maelstrom 9.59 9.41
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 52.25 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data li_lvb Fight Length
Count 7689
Mean 299.99
Minimum 240.02
Maximum 359.97
Spread ( max - min ) 119.95
Range [ ( max - min ) / 2 * 100% ] 19.99%
Standard Deviation 36.0417
5th Percentile 245.66
95th Percentile 354.30
( 95th Percentile - 5th Percentile ) 108.64
Mean Distribution
Standard Deviation 0.4110
95.00% Confidence Intervall ( 299.18 - 300.80 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 555
0.1% Error 55449
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1109
DPS
Sample Data li_lvb Damage Per Second
Count 7689
Mean 1128516.89
Minimum 998042.49
Maximum 1305093.68
Spread ( max - min ) 307051.19
Range [ ( max - min ) / 2 * 100% ] 13.60%
Standard Deviation 40373.5502
5th Percentile 1064261.13
95th Percentile 1197192.57
( 95th Percentile - 5th Percentile ) 132931.44
Mean Distribution
Standard Deviation 460.4283
95.00% Confidence Intervall ( 1127614.47 - 1129419.31 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4917
0.1 Scale Factor Error with Delta=300 13914819
0.05 Scale Factor Error with Delta=300 55659275
0.01 Scale Factor Error with Delta=300 1391481861
Priority Target DPS
Sample Data li_lvb Priority Target Damage Per Second
Count 7689
Mean 1128516.89
Minimum 998042.49
Maximum 1305093.68
Spread ( max - min ) 307051.19
Range [ ( max - min ) / 2 * 100% ] 13.60%
Standard Deviation 40373.5502
5th Percentile 1064261.13
95th Percentile 1197192.57
( 95th Percentile - 5th Percentile ) 132931.44
Mean Distribution
Standard Deviation 460.4283
95.00% Confidence Intervall ( 1127614.47 - 1129419.31 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4917
0.1 Scale Factor Error with Delta=300 13914819
0.05 Scale Factor Error with Delta=300 55659275
0.01 Scale Factor Error with Delta=300 1391481861
DPS(e)
Sample Data li_lvb Damage Per Second (Effective)
Count 7689
Mean 1128516.89
Minimum 998042.49
Maximum 1305093.68
Spread ( max - min ) 307051.19
Range [ ( max - min ) / 2 * 100% ] 13.60%
Damage
Sample Data li_lvb Damage
Count 7689
Mean 304569456.82
Minimum 220393687.86
Maximum 386970192.24
Spread ( max - min ) 166576504.38
Range [ ( max - min ) / 2 * 100% ] 27.35%
DTPS
Sample Data li_lvb Damage Taken Per Second
Count 7689
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data li_lvb Healing Per Second
Count 7689
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data li_lvb Healing Per Second (Effective)
Count 7689
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data li_lvb Heal
Count 7689
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data li_lvb Healing Taken Per Second
Count 7689
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data li_lvb Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data li_lvbTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data li_lvb Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.96 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.15 totem_mastery,if=buff.resonance_totem.remains<2
9 3.33 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 7.79 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.31 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.23 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 21.25 elemental_blast
Keep your EB always on Cooldown.
I 11.23 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.23 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.33 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.50 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 55.98 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 30.51 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.46 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 3.65 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 1.96 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 17.17 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 64.28 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNNSSOSSMSHMSSSPAMMRRMRPSHMMRRKGGNMNORSHSMISSSSMRHRPJLMMMKGGLGHLGMIFMMRARRSHIM97OMSSMSKHNNMNNSSSSMHIQMOMMRAJLLPHMKNNNMMNSSHMAMRORRIMMMHMRRMIKNNRRHMNNRRMROSSHIJMSSMSSM9IHKNMNSANSSNMHOSSSMSSSSPHMMQRKNNMNNOHRRMARSIJMMMHSSSPMMSSKAMGHMGMGNOMSMSHISSMSSSSMHIKNMNM9

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.058 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.058 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.875 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.939 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:03.955 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:04.971 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:05.988 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:06.750 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:07.513 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:08.291 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:09.070 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.849 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.630 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:11.392 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:12.155 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:13.170 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:14.235 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:15.300 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:16.366 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.183 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:18.267 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:19.353 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:20.440 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:21.255 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:21.255 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:22.342 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:23.160 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:24.246 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:25.333 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.151 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.236 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.054 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.142 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.230 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.265 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.042 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.076 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.114 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:35.151 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, potion_of_prolonged_power
0:35.930 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
0:36.708 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, potion_of_prolonged_power
0:37.486 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, extracted_sanity, potion_of_prolonged_power
0:38.522 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:39.303 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:40.081 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:41.116 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:42.527 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:43.911 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:45.294 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:46.677 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:47.715 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:49.100 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.510 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.920 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.332 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.744 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.156 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.567 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.978 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.036 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.095 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.154 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.214 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:04.599 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:05.639 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:07.023 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:08.062 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:09.100 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:10.158 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:11.216 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:12.626 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_mastery, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:13.684 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:14.695 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.705 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.715 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.724 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.734 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.079 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.425 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.425 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.772 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.118 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.529 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.941 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.951 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.298 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.308 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.308 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.317 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:32.307 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:33.626 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:34.945 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:36.266 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:37.587 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:38.970 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:40.353 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, potion_of_prolonged_power
1:41.364 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
1:42.375 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, potion_of_prolonged_power
1:43.723 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, potion_of_prolonged_power
1:44.734 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, extracted_sanity, potion_of_prolonged_power
1:45.744 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:47.064 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:48.383 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:49.703 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:51.024 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:52.435 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:53.846 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.905 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.658 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.718 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.777 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.187 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.247 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.656 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.656 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.717 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.776 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.834 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.896 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.306 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.716 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.379 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:11.437 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:12.498 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:13.558 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:14.617 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:16.029 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:17.087 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:18.147 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.559 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.971 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.031 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.031 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.441 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.852 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.910 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.321 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.733 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:29.772 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:30.812 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.195 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.233 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.617 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:35.655 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:37.039 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:38.422 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:39.835 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:40.895 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:42.308 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, mark_of_the_claw
2:43.348 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, mark_of_the_claw
2:44.386 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, mark_of_the_claw
2:45.769 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, mark_of_the_claw
2:47.153 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:48.536 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:49.885 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:50.894 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:51.906 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.252 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.597 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.944 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:57.291 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:58.302 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:59.649 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:01.032 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:02.416 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:03.455 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:04.447 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.767 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:06.758 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.749 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.740 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.732 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.054 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.375 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.384 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.443 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.854 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.203 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:18.214 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:19.560 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
3:20.570 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
3:21.915 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
3:21.915 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
3:22.926 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
3:24.273 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
3:25.621 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
3:26.612 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:27.995 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:29.378 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.371 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.691 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.039 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.386 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:35.734 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:37.055 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:38.376 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:39.699 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:41.083 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:42.142 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:43.554 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:44.614 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:46.024 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.779 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.191 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:49.575 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:50.613 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:51.652 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:53.036 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:54.076 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:55.135 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.194 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.607 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.954 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.300 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.647 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.647 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.991 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:04.338 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.349 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.361 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.371 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.717 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:09.756 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:11.140 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:12.180 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:13.218 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:14.257 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.316 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:16.353 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:17.737 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:19.121 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:20.506 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.917 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:21.917 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:22.976 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:24.036 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:25.449 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
4:26.488 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
4:27.526 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
4:28.908 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
4:29.950 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
4:30.989 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.049 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.108 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:34.520 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:35.932 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:37.344 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:38.854 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:39.914 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:41.325 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:42.736 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:44.146 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:45.557 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:46.940 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:48.324 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:49.706 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:51.089 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:52.474 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:53.512 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:54.896 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
4:55.935 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:56.996 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:58.056 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:59.468 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="li_lvb"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:7:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

mb_lvs : 1123111 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1123111.4 1123111.4 897.6 / 0.080% 158532.2 / 14.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 52.7 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
mb_lvs 1123111
Earth Shock 101858 9.1% 15.5 18.63sec 1973166 1970621 Direct 15.5 1374620 3807669 1973237 24.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.48 15.48 0.00 0.00 1.0014 0.0000 30550542.13 30550542.13 0.00 1970621.31 1970621.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.67 75.40% 1374619.89 1149885 1618024 1375040.90 1265710 1513392 16047331 16047331 0.00
crit 3.81 24.60% 3807669.34 3182882 4478691 3740588.91 0 4478691 14503211 14503211 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 62450 (95460) 5.6% (8.5%) 22.0 13.81sec 1300648 957298 Direct 22.0 594213 1645211 852808 24.6%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 21.95 0.00 0.00 1.3587 0.0000 18721949.85 18721949.85 0.00 957298.19 957298.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.55 75.39% 594212.68 528062 659824 594381.99 566339 625266 9834735 9834735 0.00
crit 5.40 24.61% 1645211.40 1461674 1826393 1642497.26 0 1826393 8887215 8887215 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33010 2.9% 13.9 21.26sec 711279 0 Direct 13.9 499100 1382141 712843 24.2%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.91 13.88 0.00 0.00 0.0000 0.0000 9897436.86 9897436.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.52 75.80% 499099.65 443572 554252 499271.39 464696 537312 5252716 5252716 0.00
crit 3.36 24.20% 1382141.42 1227806 1534170 1348376.83 0 1534170 4644721 4644721 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 120754 10.7% 11.2 27.79sec 3222556 3286429 Direct 11.2 88122 247495 209291 76.0%  
Periodic 226.4 48561 185235 149244 73.7% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 226.43 226.43 0.9806 1.3170 36140856.48 36140856.48 0.00 116887.69 3286428.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.69 23.97% 88122.34 78852 98528 87144.03 0 98528 236879 236879 0.00
crit 8.53 76.03% 247495.43 218264 272724 247552.26 233267 263487 2110356 2110356 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.6 26.33% 48561.36 170 54191 48553.65 44468 51116 2895267 2895267 0.00
crit 166.8 73.67% 185234.73 125 210001 185329.62 173786 194221 30898355 30898355 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123165 11.0% 38.2 7.57sec 965621 981440 Direct 38.2 667182 1849179 965611 25.2%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.22 38.22 0.00 0.00 0.9839 0.0000 36904108.51 36904108.51 0.00 981440.04 981440.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.57 74.75% 667181.89 552564 746421 667507.96 633108 713872 19060390 19060390 0.00
crit 9.65 25.25% 1849179.28 1591505 2066092 1848473.33 1653511 2066092 17843719 17843719 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35436 (54411) 3.2% (4.8%) 9.7 32.25sec 1686980 1286872 Direct 9.6 756387 2096690 1101576 25.7%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.66 9.64 0.00 0.00 1.3109 0.0000 10616634.95 10616634.95 0.00 1286872.40 1286872.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.16 74.25% 756386.72 672025 839709 756567.40 677957 839709 5413179 5413179 0.00
crit 2.48 25.75% 2096689.70 1860166 2324315 1974791.47 0 2324315 5203456 5203456 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18976 1.7% 6.1 47.16sec 924899 0 Direct 6.1 635525 1761820 926651 25.8%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.15 6.14 0.00 0.00 0.0000 0.0000 5684177.71 5684177.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.55 74.17% 635525.11 564501 705356 633753.47 0 705356 2891772 2891772 0.00
crit 1.58 25.83% 1761819.50 1562539 1952425 1439854.43 0 1952425 2792406 2792406 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Insidious Corruption 14599 1.3% 5.1 60.45sec 857720 0 Periodic 48.0 73690 150154 91370 23.1% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.11 0.00 47.98 47.98 0.0000 1.2494 4384227.91 4384227.91 0.00 73130.19 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 76.88% 73690.24 109 76542 73682.48 68663 76542 2718485 2718485 0.00
crit 11.1 23.12% 150154.18 222 156146 150134.27 108812 156146 1665743 1665743 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 160623 (249673) 14.3% (22.3%) 58.0 5.13sec 1290436 1069390 Direct 57.9 0 832225 832225 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.02 57.87 0.00 0.00 1.2067 0.0000 48162205.25 48162205.25 0.00 1069389.67 1069389.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 57.87 100.00% 832225.37 750443 937694 832347.61 804340 865667 48162205 48162205 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 80574 7.2% 37.0 7.98sec 653267 0 Direct 36.9 0 655407 655407 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.99 36.87 0.00 0.00 0.0000 0.0000 24165550.39 24165550.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 36.87 100.00% 655407.49 590994 738458 655486.60 628656 686706 24165550 24165550 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8476 0.8% 43.1 6.27sec 59000 0 Direct 43.1 46935 95747 59000 24.7%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.05 43.05 0.00 0.00 0.0000 0.0000 2540215.14 2540215.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.41 75.28% 46934.68 44808 50897 46946.02 44808 50164 1521253 1521253 0.00
crit 10.64 24.72% 95747.05 91408 103831 95729.67 0 103831 1018962 1018962 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 100381 (184840) 8.9% (16.5%) 89.1 3.27sec 621442 492647 Direct 89.1 237059 647862 337398 24.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.14 89.14 0.00 0.00 1.2614 0.0000 30078471.85 30078471.85 0.00 492646.90 492646.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.37 75.57% 237058.81 156284 585841 237243.43 202963 279555 15970116 15970116 0.00
crit 21.78 24.43% 647862.02 432595 1621608 647937.84 467451 940305 14108356 14108356 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 84459 7.5% 88.0 4.07sec 287739 0 Direct 88.0 202028 552487 287730 24.5%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.99 87.99 0.00 0.00 0.0000 0.0000 25318686.63 25318686.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.47 75.54% 202027.85 131279 492107 201999.01 149208 259935 13429349 13429349 0.00
crit 21.52 24.46% 552486.73 363380 1362151 552215.66 384491 886764 11889337 11889337 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45584 (66649) 4.0% (5.9%) 3.0 120.40sec 6655449 0 Direct 94.1 116064 236771 144126 23.3%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 94.15 94.15 0.00 0.0000 0.6137 13569459.43 13569459.43 0.00 343367.76 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.26 76.75% 116064.33 116064 116064 116064.33 116064 116064 8386589 8386589 0.00
crit 21.89 23.25% 236771.23 236771 236771 236771.23 236771 236771 5182870 5182870 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21065 1.9% 37.5 6.98sec 167334 0 Direct 37.3 135409 276235 167988 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.47 37.33 0.00 0.00 0.0000 0.0000 6270673.13 6270673.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.69 76.86% 135409.19 135409 135409 135409.19 135409 135409 3884936 3884936 0.00
crit 8.64 23.14% 276234.76 276235 276235 276199.60 0 276235 2385737 2385737 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 134451 / 86255
Fire Blast 134451 7.7% 97.0 3.01sec 265713 136879 Direct 97.0 213203 426417 265711 24.6%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.96 96.96 0.00 0.00 1.9412 0.0000 25764866.75 25764866.75 0.00 136878.98 136878.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.08 75.37% 213202.93 201607 229011 213258.40 207434 222124 15581741 15581741 0.00
crit 23.88 24.63% 426417.40 403214 458023 426531.31 410214 446634 10183126 10183126 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 178991 / 25446
Lightning Blast 178991 2.3% 39.5 7.14sec 192642 195952 Direct 39.5 156548 313171 192637 23.0%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.54 39.54 0.00 0.00 0.9831 0.0000 7616646.41 7616646.41 0.00 195951.80 195951.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.43 76.95% 156547.65 149339 169638 156588.87 151184 165913 4763137 4763137 0.00
crit 9.11 23.05% 313171.10 298677 339276 313267.62 298677 339276 2853509 2853509 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
mb_lvs
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 105.76sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.47 0.00 0.00 0.00 1.0424 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.65sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8409 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 112.86sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5185 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 24.9sec 32.22% 32.22% 3.1(3.1) 8.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.5 1.4 27.4sec 23.8sec 34.66% 34.66% 1.4(1.4) 10.2

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.5 1.4 27.4sec 23.8sec 34.65% 34.65% 1.4(1.4) 10.2

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 27.9sec 23.4sec 33.85% 33.85% 1.8(1.8) 9.9

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.2 27.1 4.2sec 3.0sec 60.40% 63.43% 27.1(33.8) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:26.57%
  • elemental_focus_2:33.83%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.17% 19.17% 0.0(0.0) 4.7

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.2sec 32.2sec 21.30% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.64%
  • icefury_2:6.16%
  • icefury_3:5.17%
  • icefury_4:3.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 21.3 1.3 13.6sec 12.8sec 10.19% 38.43% 1.3(1.3) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.19%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.0sec 17.0sec 30.00% 30.00% 4.2(4.2) 12.7

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 94.4sec 0.0sec 39.92% 39.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.3 1.4 37.5sec 30.7sec 22.67% 25.45% 1.4(3.0) 0.1

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.42%
  • power_of_the_maelstrom_2:6.64%
  • power_of_the_maelstrom_3:9.62%

Trigger Attempt Success

  • trigger_pct:15.04%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 13.06% 9.62% 0.0(0.0) 0.3

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.59%
  • stormkeeper_2:3.86%
  • stormkeeper_3:4.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 112.9sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 22.6 12.8sec
Lava Surge: Wasted 1.3 79.5sec
Lava Surge: During Lava Burst 3.7 58.6sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7210.0014.8672.6290.0008.700
Fire Elemental0.5100.0011.5660.5860.0003.622
Lava Burst0.9340.0019.5797.4840.00026.203
Elemental Blast0.5550.0014.3619.3212.08518.200
Icefury1.0590.0018.0167.7610.00129.546

Resources

Resource Usage Type Count Total Average RPE APR
mb_lvs
earth_shock Maelstrom 124.1 14905.4 120.1 962.7 2049.6
flame_shock Maelstrom 89.9 1605.6 17.9 143.2 22509.3
frost_shock Maelstrom 306.4 6128.2 20.0 160.3 6022.0
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 465.16 5521.53 (23.93%) 11.87 60.39 1.08%
Lava Burst Overload Maelstrom 296.58 2574.21 (11.16%) 8.68 95.02 3.56%
Lightning Bolt Maelstrom 714.68 5702.01 (24.71%) 7.98 15.40 0.27%
Lightning Bolt Overload Maelstrom 705.44 4180.85 (18.12%) 5.93 51.81 1.22%
Icefury Maelstrom 77.47 1848.57 (8.01%) 23.86 10.73 0.58%
Icefury Overload Maelstrom 49.27 876.60 (3.80%) 17.79 10.33 1.17%
Resonance Totem Maelstrom 2392.90 2369.41 (10.27%) 0.99 23.50 0.98%
Resource RPS-Gain RPS-Loss
Maelstrom 9.59 9.41
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.16 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data mb_lvs Fight Length
Count 7857
Mean 300.01
Minimum 239.96
Maximum 360.05
Spread ( max - min ) 120.08
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 36.0631
5th Percentile 245.80
95th Percentile 354.19
( 95th Percentile - 5th Percentile ) 108.39
Mean Distribution
Standard Deviation 0.4069
95.00% Confidence Intervall ( 299.21 - 300.80 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 556
0.1% Error 55510
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1111
DPS
Sample Data mb_lvs Damage Per Second
Count 7857
Mean 1123111.39
Minimum 970415.22
Maximum 1277124.38
Spread ( max - min ) 306709.17
Range [ ( max - min ) / 2 * 100% ] 13.65%
Standard Deviation 40592.4984
5th Percentile 1059521.72
95th Percentile 1192958.05
( 95th Percentile - 5th Percentile ) 133436.33
Mean Distribution
Standard Deviation 457.9493
95.00% Confidence Intervall ( 1122213.83 - 1124008.96 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5019
0.1 Scale Factor Error with Delta=300 14066150
0.05 Scale Factor Error with Delta=300 56264599
0.01 Scale Factor Error with Delta=300 1406614965
Priority Target DPS
Sample Data mb_lvs Priority Target Damage Per Second
Count 7857
Mean 1123111.39
Minimum 970415.22
Maximum 1277124.38
Spread ( max - min ) 306709.17
Range [ ( max - min ) / 2 * 100% ] 13.65%
Standard Deviation 40592.4984
5th Percentile 1059521.72
95th Percentile 1192958.05
( 95th Percentile - 5th Percentile ) 133436.33
Mean Distribution
Standard Deviation 457.9493
95.00% Confidence Intervall ( 1122213.83 - 1124008.96 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5019
0.1 Scale Factor Error with Delta=300 14066150
0.05 Scale Factor Error with Delta=300 56264599
0.01 Scale Factor Error with Delta=300 1406614965
DPS(e)
Sample Data mb_lvs Damage Per Second (Effective)
Count 7857
Mean 1123111.39
Minimum 970415.22
Maximum 1277124.38
Spread ( max - min ) 306709.17
Range [ ( max - min ) / 2 * 100% ] 13.65%
Damage
Sample Data mb_lvs Damage
Count 7857
Mean 303005196.21
Minimum 209815016.62
Maximum 393311094.27
Spread ( max - min ) 183496077.65
Range [ ( max - min ) / 2 * 100% ] 30.28%
DTPS
Sample Data mb_lvs Damage Taken Per Second
Count 7857
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data mb_lvs Healing Per Second
Count 7857
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data mb_lvs Healing Per Second (Effective)
Count 7857
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data mb_lvs Heal
Count 7857
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data mb_lvs Healing Taken Per Second
Count 7857
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data mb_lvs Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data mb_lvsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data mb_lvs Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.98 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.16 totem_mastery,if=buff.resonance_totem.remains<2
9 3.41 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 7.95 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.42 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.40 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 21.71 elemental_blast
Keep your EB always on Cooldown.
I 11.47 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.33 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.53 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.62 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 57.14 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.14 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.60 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 3.74 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.00 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 17.72 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 65.53 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNSNSSSSMMHFMSMISAMSSSSSSHIMSSKNNNMNOSSHSSMSSSPSMRHRJLMPSKNNNMHNSSFSMMSAMSSHIMSM97SMSSIHKMNNFSSNMMHNQRRMRAJOSMIHMLLRKMGMNNHNASMSSPSMORHMRRMSPSKNMHNNNSSMSSSSHIJMSOSMSSSHK9GMAGNMGMSHISSMSOSMSSHMPQRKMNNNRNHMMAMORSJMSIHSSSMSSSSAIKHMMNNNMNOMSSHSSMSISSSMHSKNNM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.875 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.940 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:03.958 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:04.975 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:05.992 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:06.755 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:07.519 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:08.297 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:09.075 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:09.855 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.633 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.412 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.449 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.486 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.302 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.389 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.477 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.254 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.032 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.069 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.847 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.626 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.662 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.662 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.699 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.735 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.770 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.807 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.843 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.930 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.017 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.084 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.884 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.950 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.016 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:34.081 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:35.148 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:35.948 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:36.746 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:37.546 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:38.612 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.411 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:40.210 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:41.276 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:42.659 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:44.043 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:45.363 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:46.685 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.031 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.376 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:50.694 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:52.014 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:53.007 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:54.329 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:55.712 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.121 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.534 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.880 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.012 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.022 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.368 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.380 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.390 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.737 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:07.747 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:08.757 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:09.817 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:11.228 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:12.639 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:13.649 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:14.658 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:16.005 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:17.015 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:18.336 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:19.328 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:20.647 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:21.966 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:21.966 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:22.959 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:24.305 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:25.718 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:27.129 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:28.187 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:29.599 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:31.011 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:32.069 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:33.128 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:33.128 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:34.539 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:35.953 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:37.365 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:38.778 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:39.835 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:41.247 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:42.660 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:44.070 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:45.131 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:46.191 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
1:47.251 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
1:48.663 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
1:50.074 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
1:51.133 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:52.194 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:53.606 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:55.017 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:56.027 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:56.783 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.105 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:59.424 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.744 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.065 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.065 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.076 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.087 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.097 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.157 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.217 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.627 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.038 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_mastery, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.100 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.159 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.571 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:14.981 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:16.040 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:17.101 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:18.514 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:19.573 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:20.635 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:22.046 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:23.103 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.103 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.517 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.930 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.341 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.752 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:29.813 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.223 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:32.606 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:33.646 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:35.028 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:36.414 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:37.403 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:38.723 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:40.070 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:41.416 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:42.762 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:43.772 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:45.118 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:46.464 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity
2:47.524 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:48.935 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:50.346 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
2:51.405 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:52.463 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:53.523 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.933 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.344 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:57.756 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:59.167 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.579 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.990 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.403 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.814 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.873 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:06.933 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.345 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:09.384 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:10.423 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:11.461 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:12.845 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:13.884 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:15.268 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.680 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.222 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.634 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:20.693 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:21.753 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:23.164 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:23.164 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:24.224 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:25.283 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:26.344 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:27.403 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.815 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.227 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.610 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.601 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.921 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:35.242 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:36.562 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:37.907 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.917 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:40.263 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:41.274 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:42.622 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:44.033 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:45.417 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:46.737 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:47.730 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:48.484 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:49.804 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:51.150 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:52.496 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:53.506 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
3:54.519 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
3:55.530 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:56.943 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:58.002 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.415 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.475 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.887 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.887 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.948 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.008 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.419 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.830 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.988 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.400 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.459 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.519 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.931 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:13.941 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:14.950 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:16.297 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:17.645 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:18.992 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.337 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:21.683 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:23.030 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:23.030 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:24.090 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:25.502 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:26.915 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:27.974 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:29.385 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
4:30.424 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
4:31.463 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
4:32.501 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
4:33.540 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
4:34.578 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:35.638 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:37.048 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:38.461 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:39.874 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:41.286 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:42.696 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:44.108 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:45.520 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:46.934 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:47.994 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:49.379 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:50.763 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:52.145 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:53.527 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:54.911 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.257 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.602 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:58.611 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:59.621 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="mb_lvs"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:7:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

tgt_eq : 1110717 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1110716.7 1110716.7 888.1 / 0.080% 157407.6 / 14.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 52.7 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
tgt_eq 1110717
Earth Shock 102183 9.2% 15.5 18.65sec 1979323 1976531 Direct 15.5 1375261 3807938 1979210 24.8%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.49 15.49 0.00 0.00 1.0014 0.0000 30654019.30 30654019.30 0.00 1976531.00 1976531.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.64 75.17% 1375260.55 1149885 1618024 1375759.18 1249476 1509004 16009608 16009608 0.00
crit 3.85 24.83% 3807938.33 3182882 4478691 3754230.45 0 4478691 14644411 14644411 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 62607 (95654) 5.6% (8.6%) 22.0 13.81sec 1302747 958773 Direct 22.0 594217 1645823 854832 24.8%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 21.96 0.00 0.00 1.3588 0.0000 18770728.73 18770728.73 0.00 958773.05 958773.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.52 75.22% 594217.12 528062 659824 594397.93 563767 628782 9814411 9814411 0.00
crit 5.44 24.78% 1645822.86 1461674 1826393 1641918.26 0 1826393 8956318 8956318 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33047 3.0% 13.9 21.29sec 713626 0 Direct 13.8 499200 1382779 715450 24.5%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.88 13.84 0.00 0.00 0.0000 0.0000 9905214.46 9905214.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.46 75.53% 499199.98 443572 554252 499349.92 459042 548869 5219759 5219759 0.00
crit 3.39 24.47% 1382779.18 1227806 1534170 1348938.20 0 1534170 4685455 4685455 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 120875 10.9% 11.2 27.78sec 3227272 3291757 Direct 11.2 88165 247475 209463 76.1%  
Periodic 226.4 48567 185261 149410 73.8% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 226.43 226.43 0.9804 1.3170 36179703.29 36179703.29 0.00 117014.09 3291757.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.68 23.86% 88164.77 78852 98528 86838.08 0 98528 235867 235867 0.00
crit 8.54 76.14% 247475.31 218264 272724 247515.68 232003 263293 2112265 2112265 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.4 26.22% 48566.78 101 54191 48562.22 44978 51313 2883720 2883720 0.00
crit 167.0 73.78% 185260.53 274 210001 185352.30 175359 193840 30947850 30947850 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123152 11.1% 38.2 7.57sec 965339 981190 Direct 38.2 667143 1849312 965264 25.2%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.22 38.22 0.00 0.00 0.9839 0.0000 36895684.23 36895684.23 0.00 981189.91 981189.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.58 74.78% 667143.16 574966 746421 667432.87 634651 709832 19066603 19066603 0.00
crit 9.64 25.22% 1849312.09 1455090 2066092 1848821.91 0 2039336 17829081 17829081 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35476 (54514) 3.2% (4.9%) 9.7 32.25sec 1689904 1289261 Direct 9.6 756371 2095329 1102093 25.8%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.66 9.64 0.00 0.00 1.3108 0.0000 10625733.77 10625733.77 0.00 1289261.15 1289261.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.15 74.17% 756370.95 672025 839709 756698.54 686854 839709 5408551 5408551 0.00
crit 2.49 25.83% 2095328.87 1860166 2324315 1983860.94 0 2324315 5217182 5217182 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 19037 1.7% 6.2 47.20sec 922809 0 Direct 6.2 635180 1761232 924933 25.7%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.18 6.16 0.00 0.00 0.0000 0.0000 5701469.44 5701469.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.58 74.26% 635179.98 564501 705356 633973.67 0 705356 2907230 2907230 0.00
crit 1.59 25.74% 1761231.71 1562539 1952425 1445866.63 0 1952425 2794239 2794239 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.270000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Insidious Corruption 14593 1.3% 5.1 60.44sec 856373 0 Periodic 48.0 73695 150157 91354 23.1% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 0.00 47.98 47.98 0.0000 1.2496 4382634.27 4382634.27 0.00 73106.04 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 76.91% 73695.48 109 76542 73685.34 70094 76542 2719197 2719197 0.00
crit 11.1 23.09% 150157.00 222 156146 150118.02 94236 156146 1663438 1663438 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 150429 (236159) 13.6% (21.3%) 58.1 5.11sec 1218957 1010611 Direct 58.0 0 778370 778370 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.09 57.95 0.00 0.00 1.2062 0.0000 45106761.44 45106761.44 0.00 1010611.33 1010611.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 57.95 100.00% 778369.80 701650 876726 778480.06 753323 811252 45106761 45106761 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77233 7.0% 36.9 7.98sec 626877 0 Direct 36.8 0 628859 628859 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.94 36.83 0.00 0.00 0.0000 0.0000 23159482.35 23159482.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 36.83 100.00% 628859.38 566884 708333 628953.24 602328 662977 23159482 23159482 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8497 0.8% 43.2 6.34sec 58971 0 Direct 43.2 46944 95797 58970 24.6%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.21 43.21 0.00 0.00 0.0000 0.0000 2548302.49 2548302.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.57 75.38% 46944.19 44808 50897 46954.96 44808 49775 1529184 1529184 0.00
crit 10.64 24.62% 95797.30 91408 103831 95782.85 0 103831 1019119 1019119 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 100433 (185041) 9.0% (16.7%) 89.1 3.28sec 622565 493490 Direct 89.1 237287 647194 337871 24.5%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.08 89.08 0.00 0.00 1.2616 0.0000 30097242.28 30097242.28 0.00 493489.96 493489.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.22 75.46% 237287.09 156284 585841 237479.25 198745 273028 15951192 15951192 0.00
crit 21.86 24.54% 647193.75 432595 1621608 647555.08 471843 1012073 14146050 14146050 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 84608 7.6% 87.9 4.08sec 288463 0 Direct 87.9 202584 552739 288462 24.5%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.91 87.91 0.00 0.00 0.0000 0.0000 25360172.13 25360172.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.35 75.47% 202583.69 131279 492107 202603.51 151864 255525 13442091 13442091 0.00
crit 21.56 24.53% 552739.41 363380 1362151 552449.02 392015 831321 11918081 11918081 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45527 (66586) 4.1% (6.0%) 3.0 120.41sec 6639379 0 Direct 94.1 116064 236771 144000 23.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 94.09 94.09 0.00 0.0000 0.6136 13549244.12 13549244.12 0.00 343283.49 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.32 76.86% 116064.33 116064 116064 116064.33 116064 116064 8393547 8393547 0.00
crit 21.78 23.14% 236771.23 236771 236771 236771.23 236771 236771 5155697 5155697 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21059 1.9% 37.4 7.05sec 167494 0 Direct 37.3 135409 276235 168168 23.3%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.44 37.29 0.00 0.00 0.0000 0.0000 6270914.96 6270914.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.62 76.74% 135409.19 135409 135409 135409.19 135409 135409 3874806 3874806 0.00
crit 8.67 23.26% 276234.76 276235 276235 276234.76 276235 276235 2396109 2396109 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 134612 / 86473
Fire Blast 134612 7.8% 97.1 3.00sec 266004 137015 Direct 97.1 213205 426482 266005 24.8%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.11 97.11 0.00 0.00 1.9414 0.0000 25830765.72 25830765.72 0.00 137015.07 137015.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.07 75.24% 213204.54 201607 229011 213254.90 207856 221710 15577993 15577993 0.00
crit 24.04 24.76% 426482.31 403214 458023 426583.13 410135 446798 10252773 10252773 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 179189 / 25487
Lightning Blast 179189 2.3% 39.5 7.15sec 192879 196160 Direct 39.5 156590 313210 192874 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.55 39.55 0.00 0.00 0.9833 0.0000 7627663.08 7627663.08 0.00 196159.52 196159.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.38 76.83% 156589.73 149339 169638 156626.65 151047 166618 4757659 4757659 0.00
crit 9.16 23.17% 313209.65 298677 339276 313253.48 298677 339276 2870004 2870004 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
tgt_eq
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 105.68sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.47 0.00 0.00 0.00 1.0422 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.64sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8408 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 112.90sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5188 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.0sec 32.17% 32.17% 3.1(3.1) 8.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.3sec 23.7sec 34.78% 34.78% 1.4(1.4) 10.2

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.5 1.4 27.4sec 23.8sec 34.62% 34.62% 1.4(1.4) 10.1

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 28.1sec 23.6sec 33.65% 33.65% 1.8(1.8) 9.9

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.3 27.3 4.2sec 3.0sec 60.54% 63.54% 27.3(33.9) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:26.65%
  • elemental_focus_2:33.89%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.15% 19.15% 0.0(0.0) 4.7

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.2sec 32.2sec 21.25% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.61%
  • icefury_2:6.14%
  • icefury_3:5.17%
  • icefury_4:3.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 21.4 1.2 13.5sec 12.7sec 10.23% 38.54% 1.2(1.2) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.23%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.1sec 17.2sec 29.86% 29.86% 4.2(4.2) 12.6

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 94.3sec 0.0sec 39.92% 39.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.3 1.5 37.6sec 30.6sec 22.66% 25.46% 1.5(3.0) 0.1

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.45%
  • power_of_the_maelstrom_2:6.60%
  • power_of_the_maelstrom_3:9.61%

Trigger Attempt Success

  • trigger_pct:15.05%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 112.9sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 13.05% 9.63% 0.0(0.0) 0.3

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.56%
  • stormkeeper_2:3.85%
  • stormkeeper_3:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 112.9sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 22.6 12.7sec
Lava Surge: Wasted 1.3 81.7sec
Lava Surge: During Lava Burst 3.7 57.8sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7200.0014.5902.6270.0008.567
Fire Elemental0.5080.0011.5660.5880.0003.472
Lava Burst0.9340.00110.9507.5160.00025.008
Elemental Blast0.5540.0014.4459.2923.08918.419
Icefury1.0620.0018.3007.7730.37823.382

Resources

Resource Usage Type Count Total Average RPE APR
tgt_eq
earth_shock Maelstrom 123.7 14858.5 120.1 959.4 2063.1
flame_shock Maelstrom 89.6 1598.7 17.9 142.6 22630.2
frost_shock Maelstrom 305.3 6106.7 20.0 159.8 6041.8
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 464.11 5508.74 (23.96%) 11.87 60.62 1.09%
Lava Burst Overload Maelstrom 295.15 2561.08 (11.14%) 8.68 95.24 3.59%
Lightning Bolt Maelstrom 711.60 5677.72 (24.70%) 7.98 15.11 0.27%
Lightning Bolt Overload Maelstrom 702.30 4161.95 (18.10%) 5.93 51.84 1.23%
Icefury Maelstrom 77.19 1841.24 (8.01%) 23.85 11.22 0.61%
Icefury Overload Maelstrom 49.35 878.14 (3.82%) 17.79 10.24 1.15%
Resonance Totem Maelstrom 2384.35 2360.85 (10.27%) 0.99 23.50 0.99%
Resource RPS-Gain RPS-Loss
Maelstrom 9.59 9.41
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 53.13 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data tgt_eq Fight Length
Count 7725
Mean 300.01
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 36.3108
5th Percentile 245.57
95th Percentile 354.46
( 95th Percentile - 5th Percentile ) 108.89
Mean Distribution
Standard Deviation 0.4131
95.00% Confidence Intervall ( 299.20 - 300.82 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 563
0.1% Error 56275
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 46
0.01 Scale Factor Error with Delta=300 1126
DPS
Sample Data tgt_eq Damage Per Second
Count 7725
Mean 1110716.65
Minimum 990986.34
Maximum 1264920.58
Spread ( max - min ) 273934.23
Range [ ( max - min ) / 2 * 100% ] 12.33%
Standard Deviation 39826.2863
5th Percentile 1046647.98
95th Percentile 1178381.31
( 95th Percentile - 5th Percentile ) 131733.33
Mean Distribution
Standard Deviation 453.1277
95.00% Confidence Intervall ( 1109828.54 - 1111604.77 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4939
0.1 Scale Factor Error with Delta=300 13540145
0.05 Scale Factor Error with Delta=300 54160578
0.01 Scale Factor Error with Delta=300 1354014426
Priority Target DPS
Sample Data tgt_eq Priority Target Damage Per Second
Count 7725
Mean 1110716.65
Minimum 990986.34
Maximum 1264920.58
Spread ( max - min ) 273934.23
Range [ ( max - min ) / 2 * 100% ] 12.33%
Standard Deviation 39826.2863
5th Percentile 1046647.98
95th Percentile 1178381.31
( 95th Percentile - 5th Percentile ) 131733.33
Mean Distribution
Standard Deviation 453.1277
95.00% Confidence Intervall ( 1109828.54 - 1111604.77 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4939
0.1 Scale Factor Error with Delta=300 13540145
0.05 Scale Factor Error with Delta=300 54160578
0.01 Scale Factor Error with Delta=300 1354014426
DPS(e)
Sample Data tgt_eq Damage Per Second (Effective)
Count 7725
Mean 1110716.65
Minimum 990986.34
Maximum 1264920.58
Spread ( max - min ) 273934.23
Range [ ( max - min ) / 2 * 100% ] 12.33%
Damage
Sample Data tgt_eq Damage
Count 7725
Mean 299207307.26
Minimum 219362277.61
Maximum 387470952.56
Spread ( max - min ) 168108674.95
Range [ ( max - min ) / 2 * 100% ] 28.09%
DTPS
Sample Data tgt_eq Damage Taken Per Second
Count 7725
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data tgt_eq Healing Per Second
Count 7725
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data tgt_eq Healing Per Second (Effective)
Count 7725
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data tgt_eq Heal
Count 7725
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data tgt_eq Healing Taken Per Second
Count 7725
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data tgt_eq Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data tgt_eqTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data tgt_eq Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.97 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.16 totem_mastery,if=buff.resonance_totem.remains<2
9 3.35 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 7.82 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.31 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.18 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 21.35 elemental_blast
Keep your EB always on Cooldown.
I 11.31 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.26 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.37 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.58 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 56.27 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 30.73 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.51 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 3.65 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 1.97 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 17.39 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 64.36 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNSSNSSSMMHFRRRIASMSSSSSHIMMSKNMNMNNMSOHSSSMIMSMSMHMIJMSSSKMGMGHNNOMSSSSASMHIMRRR97MSIHKMMNNNFSMNHMQSSMSPAJSSSHMMORKGGMGNHMMAPRMRSSMSHISSMSOSSKMGGHNNRMRPRSSMHJLLLIMMOSSK9HMNANNNMSSSSHMISMORMMRQRHMIKMNNNSMMMHANSSJMMLILLMHOMMSSSAMIKMHNNMNNRMROMHRRRIMSSSSHM9KG

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.964 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.000 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:05.036 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:06.072 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:06.851 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:07.629 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:08.406 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.185 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.964 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.742 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.520 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.557 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.594 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:14.410 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.497 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.585 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.402 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.488 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.575 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.663 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.481 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.481 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.567 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.655 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.742 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.827 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.913 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.999 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.085 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.171 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.951 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.730 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.766 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.800 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:35.032 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:35.812 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:36.589 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:37.366 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:38.145 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:38.924 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:39.704 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:40.741 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:41.829 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:42.889 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:44.272 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:45.595 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:46.916 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:48.236 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:49.557 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.569 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.579 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.927 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.938 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.284 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.342 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.753 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.765 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.777 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.010 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.355 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.365 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.373 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.385 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.731 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:07.741 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:08.751 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:10.162 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:11.221 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:12.634 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:13.646 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:14.656 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:15.665 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:17.012 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:18.359 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:19.706 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:21.051 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:22.371 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:22.371 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:23.692 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:24.731 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.115 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:27.154 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.566 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.979 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.393 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.805 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.059 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.059 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.468 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:36.878 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:37.936 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:39.521 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:40.932 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, potion_of_prolonged_power
1:41.993 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, potion_of_prolonged_power
1:43.405 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity, potion_of_prolonged_power
1:44.465 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), extracted_sanity, potion_of_prolonged_power
1:45.523 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), extracted_sanity, potion_of_prolonged_power
1:46.583 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:47.643 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:49.052 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:50.463 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:51.523 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.934 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.946 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.700 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.046 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.393 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.740 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.086 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.095 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.095 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.105 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.115 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:04.176 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:05.236 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.648 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.059 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.119 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:10.179 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.590 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:13.002 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:14.062 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:15.122 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:16.534 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:17.593 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:18.654 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.066 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:21.058 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:22.378 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:22.378 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:23.368 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:24.690 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:25.681 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:27.001 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:28.322 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:29.644 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:30.990 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:32.403 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:33.814 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:34.825 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:36.171 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:37.518 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:38.864 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:40.210 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:41.220 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:42.565 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:43.911 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:45.321 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), extracted_sanity
2:46.732 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:47.791 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:48.850 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:50.263 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:51.324 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:52.384 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.795 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.208 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.590 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.626 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.010 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.392 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.803 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.213 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.624 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.684 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:06.743 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:07.803 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.862 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.921 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.333 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.391 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.451 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.863 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.276 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.686 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:18.745 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:20.155 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:21.503 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:22.512 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:22.512 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:23.524 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:24.534 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:25.544 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.891 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:28.239 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.585 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.932 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.345 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.757 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.102 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:36.113 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:37.461 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.471 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:39.481 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:40.827 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:41.835 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:43.180 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:44.526 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:45.280 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:46.693 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.107 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:49.099 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:50.092 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:51.414 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:52.734 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:53.725 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:54.717 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:55.730 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:57.077 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:58.089 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:59.100 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:00.513 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:01.926 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:01.926 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:02.936 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.282 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.628 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.689 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.036 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.047 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.058 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.069 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.080 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_haste, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.090 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.150 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.561 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.619 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.032 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.091 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.503 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.913 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.323 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:23.323 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:24.362 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:25.399 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:26.783 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:28.166 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:29.549 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:30.589 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
4:31.629 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
4:33.013 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:34.072 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:35.132 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.543 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:37.603 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:39.014 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:40.074 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:41.485 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:42.958 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:44.302 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:45.649 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:46.995 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:48.004 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.349 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.695 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.041 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.388 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.800 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.362 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.374 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.386 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.732 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="tgt_eq"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:7:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Simulation & Raid Information

Iterations: 8008
Threads: 8
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 253956432
Max Event Queue: 51
Sim Seconds: 2402419
CPU Seconds: 166.1719
Physical Seconds: 22.2071
Speed Up: 14457

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
3ilevel 3ilevel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
3ilevel 3ilevel earth_shock 8042 31878622 106263 3.10 1390789 4066121 15.5 15.5 24.9% 0.0% 0.0% 0.0% 18.64sec 31878622 300.00sec
3ilevel 3ilevel elemental_blast 117014 19434133 64781 4.39 600735 1758127 22.0 22.0 24.6% 0.0% 0.0% 0.0% 13.81sec 19434133 300.00sec
3ilevel 3ilevel elemental_blast_overload 120588 10288180 34294 2.77 504754 1476302 13.9 13.9 24.4% 0.0% 0.0% 0.0% 21.31sec 10288180 300.00sec
3ilevel 3ilevel fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 105.66sec 0 300.00sec
3ilevel 3ilevel flame_shock 188389 2495235 8317 2.24 89103 264340 11.2 11.2 76.1% 0.0% 0.0% 0.0% 27.76sec 38423615 300.00sec
3ilevel 3ilevel flame_shock ticks -188389 35928380 119761 45.29 49099 197841 11.2 226.4 73.7% 0.0% 0.0% 0.0% 27.76sec 38423615 300.00sec
3ilevel 3ilevel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
3ilevel 3ilevel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
3ilevel 3ilevel frost_shock 196840 38293770 127647 7.64 674306 1975778 38.2 38.2 25.2% 0.0% 0.0% 0.0% 7.56sec 38293770 300.00sec
3ilevel 3ilevel icefury 210714 11020725 36736 1.93 764644 2239886 9.7 9.6 25.7% 0.0% 0.0% 0.0% 32.22sec 11020725 300.00sec
3ilevel 3ilevel icefury_overload 219271 5934072 19780 1.23 642470 1881093 6.2 6.2 25.8% 0.0% 0.0% 0.0% 47.11sec 5934072 300.00sec
3ilevel 3ilevel insidious_corruption ticks -243941 4383267 14611 9.60 73697 150111 5.1 48.0 23.1% 0.0% 0.0% 0.0% 60.45sec 4383267 300.00sec
3ilevel 3ilevel lava_burst 51505 48297365 160992 11.59 0 833504 58.1 57.9 100.0% 0.0% 0.0% 0.0% 5.12sec 48297365 300.00sec
3ilevel 3ilevel lava_burst_overload 77451 24725584 82419 7.39 0 669488 37.0 36.9 100.0% 0.0% 0.0% 0.0% 7.97sec 24725584 300.00sec
3ilevel 3ilevel volcanic_inferno 205533 2573849 8580 8.63 47459 96815 43.1 43.1 24.7% 0.0% 0.0% 0.0% 6.29sec 2573849 300.00sec
3ilevel 3ilevel lightning_bolt 188196 31260471 104202 17.82 239943 691528 89.1 89.1 24.6% 0.0% 0.0% 0.0% 3.28sec 31260471 300.00sec
3ilevel 3ilevel lightning_bolt_overload 45284 26293732 87646 17.59 204548 591111 87.9 87.9 24.4% 0.0% 0.0% 0.0% 4.08sec 26293732 300.00sec
3ilevel 3ilevel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
3ilevel 3ilevel spectral_owl 242570 13557689 45193 18.83 116064 236771 3.0 94.1 23.2% 0.0% 0.0% 0.0% 120.41sec 13557689 300.00sec
3ilevel 3ilevel spectral_blast 246442 6267779 20893 7.46 135409 276235 37.4 37.3 23.2% 0.0% 0.0% 0.0% 7.01sec 6267779 300.00sec
3ilevel 3ilevel stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.65sec 0 300.00sec
3ilevel 3ilevel totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 112.95sec 0 300.00sec
3ilevel 3ilevel_primal_fire_elemental fire_blast 57984 26075870 135914 30.33 215550 431139 97.0 97.0 24.7% 0.0% 0.0% 0.0% 3.00sec 26075870 191.86sec
3ilevel 3ilevel_greater_lightning_elemental lightning_blast 191726 7722954 181336 55.72 158323 316653 39.5 39.5 23.3% 0.0% 0.0% 0.0% 7.14sec 7722954 42.59sec
baseline baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline earth_shock 8042 30488823 101628 3.09 1366407 3782717 15.5 15.5 25.0% 0.0% 0.0% 0.0% 18.63sec 30488823 300.00sec
baseline baseline elemental_blast 117014 18592062 61973 4.39 590331 1635255 22.0 22.0 24.5% 0.0% 0.0% 0.0% 13.81sec 18592062 300.00sec
baseline baseline elemental_blast_overload 120588 9846724 32822 2.77 495998 1373545 13.9 13.9 24.4% 0.0% 0.0% 0.0% 21.24sec 9846724 300.00sec
baseline baseline fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 105.49sec 0 300.00sec
baseline baseline flame_shock 188389 2335023 7783 2.24 87536 246067 11.2 11.2 76.1% 0.0% 0.0% 0.0% 27.78sec 35927914 300.00sec
baseline baseline flame_shock ticks -188389 33592891 111976 45.28 48243 184093 11.2 226.4 73.7% 0.0% 0.0% 0.0% 27.78sec 35927914 300.00sec
baseline baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline frost_shock 196840 36724969 122415 7.65 662726 1836913 38.2 38.2 25.4% 0.0% 0.0% 0.0% 7.56sec 36724969 300.00sec
baseline baseline icefury 210714 10563240 35210 1.93 751467 2083090 9.7 9.6 25.8% 0.0% 0.0% 0.0% 32.21sec 10563240 300.00sec
baseline baseline icefury_overload 219271 5639392 18798 1.23 631241 1749814 6.2 6.1 25.6% 0.0% 0.0% 0.0% 47.15sec 5639392 300.00sec
baseline baseline insidious_corruption ticks -243941 4384610 14615 9.60 73696 150174 5.1 48.0 23.1% 0.0% 0.0% 0.0% 60.44sec 4384610 300.00sec
baseline baseline lava_burst 51505 44763148 149208 11.58 0 773215 58.0 57.9 100.0% 0.0% 0.0% 0.0% 5.10sec 44763148 300.00sec
baseline baseline lava_burst_overload 77451 23006476 76687 7.37 0 624677 36.9 36.8 100.0% 0.0% 0.0% 0.0% 7.95sec 23006476 300.00sec
baseline baseline volcanic_inferno 205533 2517854 8393 8.60 46631 95138 43.0 43.0 24.6% 0.0% 0.0% 0.0% 6.23sec 2517854 300.00sec
baseline baseline lightning_bolt 188196 29891313 99636 17.82 235743 643539 89.1 89.1 24.4% 0.0% 0.0% 0.0% 3.28sec 29891313 300.00sec
baseline baseline lightning_bolt_overload 45284 25185858 83951 17.57 201095 549301 87.9 87.9 24.6% 0.0% 0.0% 0.0% 4.09sec 25185858 300.00sec
baseline baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline spectral_owl 242570 13580980 45269 18.86 116064 236771 3.0 94.3 23.2% 0.0% 0.0% 0.0% 120.39sec 13580980 300.00sec
baseline baseline spectral_blast 246442 6287907 20959 7.49 135409 276235 37.6 37.4 23.1% 0.0% 0.0% 0.0% 7.00sec 6287907 300.00sec
baseline baseline stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.66sec 0 300.00sec
baseline baseline totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 112.99sec 0 300.00sec
baseline baseline_primal_fire_elemental fire_blast 57984 25629240 133537 30.33 211860 423628 97.0 97.0 24.7% 0.0% 0.0% 0.0% 3.00sec 25629240 191.93sec
baseline baseline_greater_lightning_elemental lightning_blast 191726 7587965 177942 55.70 155533 311148 39.6 39.6 23.2% 0.0% 0.0% 0.0% 7.14sec 7587965 42.64sec
ctt_nature ctt_nature augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ctt_nature ctt_nature earth_shock 8042 31555460 105183 3.10 1414084 3915926 15.5 15.5 25.0% 0.0% 0.0% 0.0% 18.69sec 31555460 300.01sec
ctt_nature ctt_nature elemental_blast 117014 19246030 64152 4.39 611320 1692964 22.0 22.0 24.5% 0.0% 0.0% 0.0% 13.81sec 19246030 300.01sec
ctt_nature ctt_nature elemental_blast_overload 120588 10209596 34031 2.78 513568 1422843 13.9 13.9 24.4% 0.0% 0.0% 0.0% 21.09sec 10209596 300.01sec
ctt_nature ctt_nature fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 105.85sec 0 300.01sec
ctt_nature ctt_nature flame_shock 188389 2346018 7820 2.24 88099 247484 11.2 11.2 76.0% 0.0% 0.0% 0.0% 27.77sec 36146682 300.01sec
ctt_nature ctt_nature flame_shock ticks -188389 33800663 112669 45.29 48566 185233 11.2 226.4 73.7% 0.0% 0.0% 0.0% 27.77sec 36146682 300.01sec
ctt_nature ctt_nature flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ctt_nature ctt_nature food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ctt_nature ctt_nature frost_shock 196840 36960499 123199 7.64 667114 1848814 38.2 38.2 25.4% 0.0% 0.0% 0.0% 7.56sec 36960499 300.01sec
ctt_nature ctt_nature icefury 210714 10600189 35333 1.93 756506 2097894 9.7 9.6 25.6% 0.0% 0.0% 0.0% 32.21sec 10600189 300.01sec
ctt_nature ctt_nature icefury_overload 219271 5680026 18933 1.23 635799 1762296 6.2 6.1 25.6% 0.0% 0.0% 0.0% 47.35sec 5680026 300.01sec
ctt_nature ctt_nature insidious_corruption ticks -243941 4386092 14620 9.60 73688 150225 5.1 48.0 23.2% 0.0% 0.0% 0.0% 60.44sec 4386092 300.01sec
ctt_nature ctt_nature lava_burst 51505 45024912 150080 11.57 0 778202 58.0 57.9 100.0% 0.0% 0.0% 0.0% 5.11sec 45024912 300.01sec
ctt_nature ctt_nature lava_burst_overload 77451 23146177 77152 7.36 0 628609 36.9 36.8 100.0% 0.0% 0.0% 0.0% 7.98sec 23146177 300.01sec
ctt_nature ctt_nature volcanic_inferno 205533 2540078 8467 8.62 46930 95755 43.1 43.1 24.6% 0.0% 0.0% 0.0% 6.29sec 2540078 300.01sec
ctt_nature ctt_nature lightning_bolt 188196 31040628 103467 17.83 243998 667222 89.2 89.2 24.6% 0.0% 0.0% 0.0% 3.28sec 31040628 300.01sec
ctt_nature ctt_nature lightning_bolt_overload 45284 26083122 86942 17.58 208273 568961 87.9 87.9 24.5% 0.0% 0.0% 0.0% 4.10sec 26083122 300.01sec
ctt_nature ctt_nature potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ctt_nature ctt_nature spectral_owl 242570 13550873 45169 18.83 116064 236771 3.0 94.1 23.1% 0.0% 0.0% 0.0% 120.39sec 13550873 300.01sec
ctt_nature ctt_nature spectral_blast 246442 6279669 20932 7.47 135409 276235 37.5 37.4 23.2% 0.0% 0.0% 0.0% 7.00sec 6279669 300.01sec
ctt_nature ctt_nature stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.64sec 0 300.01sec
ctt_nature ctt_nature totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.06sec 0 300.01sec
ctt_nature ctt_nature_primal_fire_elemental fire_blast 57984 25769417 134303 30.34 213199 426394 97.0 97.0 24.6% 0.0% 0.0% 0.0% 3.00sec 25769417 191.88sec
ctt_nature ctt_nature_greater_lightning_elemental lightning_blast 191726 7632302 179188 55.70 156600 313205 39.5 39.5 23.3% 0.0% 0.0% 0.0% 7.13sec 7632302 42.59sec
ea_es ea_es augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ea_es ea_es earth_shock 8042 33713308 112378 3.10 1517430 4201160 15.5 15.5 24.6% 0.0% 0.0% 0.0% 18.66sec 33713308 300.00sec
ea_es ea_es elemental_blast 117014 18717118 62391 4.39 594122 1645205 22.0 22.0 24.6% 0.0% 0.0% 0.0% 13.81sec 18717118 300.00sec
ea_es ea_es elemental_blast_overload 120588 9919127 33064 2.78 499105 1381611 13.9 13.9 24.3% 0.0% 0.0% 0.0% 21.11sec 9919127 300.00sec
ea_es ea_es fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 105.67sec 0 300.00sec
ea_es ea_es flame_shock 188389 2346139 7821 2.24 88096 247467 11.2 11.2 76.0% 0.0% 0.0% 0.0% 27.80sec 36151444 300.00sec
ea_es ea_es flame_shock ticks -188389 33805305 112684 45.29 48556 185250 11.2 226.4 73.7% 0.0% 0.0% 0.0% 27.80sec 36151444 300.00sec
ea_es ea_es flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ea_es ea_es food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ea_es ea_es frost_shock 196840 36873813 122913 7.65 667098 1849259 38.2 38.2 25.2% 0.0% 0.0% 0.0% 7.57sec 36873813 300.00sec
ea_es ea_es icefury 210714 10694665 35649 1.93 756303 2095574 9.7 9.6 26.3% 0.0% 0.0% 0.0% 32.22sec 10694665 300.00sec
ea_es ea_es icefury_overload 219271 5688625 18962 1.23 635426 1760825 6.2 6.2 25.6% 0.0% 0.0% 0.0% 46.76sec 5688625 300.00sec
ea_es ea_es insidious_corruption ticks -243941 4384853 14616 9.60 73706 150260 5.1 48.0 23.1% 0.0% 0.0% 0.0% 60.45sec 4384853 300.00sec
ea_es ea_es lava_burst 51505 45117218 150392 11.59 0 778283 58.1 58.0 100.0% 0.0% 0.0% 0.0% 5.12sec 45117218 300.00sec
ea_es ea_es lava_burst_overload 77451 23185303 77285 7.37 0 628811 37.0 36.9 100.0% 0.0% 0.0% 0.0% 8.00sec 23185303 300.00sec
ea_es ea_es volcanic_inferno 205533 2549462 8498 8.65 46941 95714 43.3 43.3 24.6% 0.0% 0.0% 0.0% 6.30sec 2549462 300.00sec
ea_es ea_es lightning_bolt 188196 30121227 100405 17.82 237086 649199 89.1 89.1 24.5% 0.0% 0.0% 0.0% 3.27sec 30121227 300.00sec
ea_es ea_es lightning_bolt_overload 45284 25323817 84413 17.59 202564 551305 88.0 88.0 24.5% 0.0% 0.0% 0.0% 4.09sec 25323817 300.00sec
ea_es ea_es potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ea_es ea_es spectral_owl 242570 13577487 45259 18.86 116064 236771 3.0 94.3 23.1% 0.0% 0.0% 0.0% 120.40sec 13577487 300.00sec
ea_es ea_es spectral_blast 246442 6293741 20979 7.49 135409 276235 37.6 37.4 23.2% 0.0% 0.0% 0.0% 7.04sec 6293741 300.00sec
ea_es ea_es stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.64sec 0 300.00sec
ea_es ea_es totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.01sec 0 300.00sec
ea_es ea_es_primal_fire_elemental fire_blast 57984 25789847 134418 30.34 213194 426514 97.0 97.0 24.7% 0.0% 0.0% 0.0% 3.00sec 25789847 191.86sec
ea_es ea_es_greater_lightning_elemental lightning_blast 191726 7636037 179141 55.70 156537 313191 39.6 39.6 23.3% 0.0% 0.0% 0.0% 7.15sec 7636037 42.63sec
ede_crit ede_crit augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ede_crit ede_crit earth_shock 8042 31467914 104891 3.10 1374795 4020464 15.5 15.5 24.7% 0.0% 0.0% 0.0% 18.59sec 31467914 300.01sec
ede_crit ede_crit elemental_blast 117014 19196214 63986 4.39 594225 1738373 22.0 22.0 24.5% 0.0% 0.0% 0.0% 13.81sec 19196214 300.01sec
ede_crit ede_crit elemental_blast_overload 120588 10197872 33992 2.78 499199 1459920 13.9 13.9 24.5% 0.0% 0.0% 0.0% 21.16sec 10197872 300.01sec
ede_crit ede_crit fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 105.58sec 0 300.01sec
ede_crit ede_crit flame_shock 188389 2463056 8210 2.24 88109 261513 11.2 11.2 75.9% 0.0% 0.0% 0.0% 27.77sec 38008686 300.01sec
ede_crit ede_crit flame_shock ticks -188389 35545631 118485 45.28 48575 195723 11.2 226.4 73.7% 0.0% 0.0% 0.0% 27.77sec 38008686 300.01sec
ede_crit ede_crit flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ede_crit ede_crit food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ede_crit ede_crit frost_shock 196840 37938439 126459 7.64 667029 1953228 38.2 38.2 25.3% 0.0% 0.0% 0.0% 7.57sec 37938439 300.01sec
ede_crit ede_crit icefury 210714 10922016 36406 1.93 756596 2213305 9.7 9.6 25.8% 0.0% 0.0% 0.0% 32.21sec 10922016 300.01sec
ede_crit ede_crit icefury_overload 219271 5840960 19470 1.23 635816 1861524 6.2 6.2 25.4% 0.0% 0.0% 0.0% 46.73sec 5840960 300.01sec
ede_crit ede_crit insidious_corruption ticks -243941 4386958 14623 9.60 73688 150266 5.1 48.0 23.2% 0.0% 0.0% 0.0% 60.45sec 4386958 300.01sec
ede_crit ede_crit lava_burst 51505 47819081 159394 11.60 0 824421 58.1 58.0 100.0% 0.0% 0.0% 0.0% 5.10sec 47819081 300.01sec
ede_crit ede_crit lava_burst_overload 77451 24494767 81648 7.40 0 662082 37.1 37.0 100.0% 0.0% 0.0% 0.0% 7.90sec 24494767 300.01sec
ede_crit ede_crit volcanic_inferno 205533 2562058 8540 8.69 46934 95775 43.5 43.5 24.6% 0.0% 0.0% 0.0% 6.25sec 2562058 300.01sec
ede_crit ede_crit lightning_bolt 188196 30896968 102988 17.81 237166 685572 89.0 89.0 24.5% 0.0% 0.0% 0.0% 3.28sec 30896968 300.01sec
ede_crit ede_crit lightning_bolt_overload 45284 26006125 86685 17.58 202303 584162 87.9 87.9 24.5% 0.0% 0.0% 0.0% 4.10sec 26006125 300.01sec
ede_crit ede_crit potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ede_crit ede_crit spectral_owl 242570 13574835 45249 18.85 116064 236771 3.0 94.2 23.2% 0.0% 0.0% 0.0% 120.41sec 13574835 300.01sec
ede_crit ede_crit spectral_blast 246442 6276513 20921 7.48 135409 276235 37.5 37.4 23.1% 0.0% 0.0% 0.0% 6.94sec 6276513 300.01sec
ede_crit ede_crit stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.65sec 0 300.01sec
ede_crit ede_crit totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.04sec 0 300.01sec
ede_crit ede_crit_primal_fire_elemental fire_blast 57984 25773534 134343 30.34 213198 426407 97.0 97.0 24.6% 0.0% 0.0% 0.0% 3.01sec 25773534 191.85sec
ede_crit ede_crit_greater_lightning_elemental lightning_blast 191726 7621559 178990 55.70 156549 313230 39.5 39.5 23.1% 0.0% 0.0% 0.0% 7.14sec 7621559 42.58sec
edi_cl edi_cl augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl earth_shock 8042 30543206 101809 3.10 1374972 3807243 15.5 15.5 24.6% 0.0% 0.0% 0.0% 18.68sec 30543206 300.01sec
edi_cl edi_cl elemental_blast 117014 18699615 62331 4.39 594076 1644907 22.0 22.0 24.5% 0.0% 0.0% 0.0% 13.81sec 18699615 300.01sec
edi_cl edi_cl elemental_blast_overload 120588 9901837 33006 2.77 499032 1382399 13.9 13.8 24.5% 0.0% 0.0% 0.0% 21.22sec 9901837 300.01sec
edi_cl edi_cl fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 105.84sec 0 300.01sec
edi_cl edi_cl flame_shock 188389 2348577 7828 2.24 88191 247449 11.2 11.2 76.1% 0.0% 0.0% 0.0% 27.79sec 36142176 300.01sec
edi_cl edi_cl flame_shock ticks -188389 33793599 112645 45.29 48590 185231 11.2 226.4 73.7% 0.0% 0.0% 0.0% 27.79sec 36142176 300.01sec
edi_cl edi_cl flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl frost_shock 196840 36810394 122699 7.64 667052 1849480 38.2 38.2 25.0% 0.0% 0.0% 0.0% 7.57sec 36810394 300.01sec
edi_cl edi_cl icefury 210714 10642534 35475 1.93 756394 2095840 9.7 9.6 25.9% 0.0% 0.0% 0.0% 32.24sec 10642534 300.01sec
edi_cl edi_cl icefury_overload 219271 5678061 18927 1.23 635480 1760617 6.2 6.1 25.6% 0.0% 0.0% 0.0% 47.09sec 5678061 300.01sec
edi_cl edi_cl insidious_corruption ticks -243941 4384524 14615 9.60 73678 150279 5.1 48.0 23.1% 0.0% 0.0% 0.0% 60.44sec 4384524 300.01sec
edi_cl edi_cl lava_burst 51505 45047045 150154 11.58 0 778171 58.0 57.9 100.0% 0.0% 0.0% 0.0% 5.12sec 45047045 300.01sec
edi_cl edi_cl lava_burst_overload 77451 23150456 77167 7.36 0 628681 36.9 36.8 100.0% 0.0% 0.0% 0.0% 8.02sec 23150456 300.01sec
edi_cl edi_cl volcanic_inferno 205533 2541129 8470 8.63 46926 95741 43.1 43.1 24.6% 0.0% 0.0% 0.0% 6.21sec 2541129 300.01sec
edi_cl edi_cl lightning_bolt 188196 30109038 100362 17.83 237119 647639 89.2 89.2 24.5% 0.0% 0.0% 0.0% 3.27sec 30109038 300.01sec
edi_cl edi_cl lightning_bolt_overload 45284 25325585 84417 17.58 202470 552631 87.9 87.9 24.5% 0.0% 0.0% 0.0% 4.08sec 25325585 300.01sec
edi_cl edi_cl potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl spectral_owl 242570 13568049 45226 18.85 116064 236771 3.0 94.2 23.1% 0.0% 0.0% 0.0% 120.39sec 13568049 300.01sec
edi_cl edi_cl spectral_blast 246442 6270100 20900 7.46 135409 276235 37.5 37.3 23.2% 0.0% 0.0% 0.0% 7.02sec 6270100 300.01sec
edi_cl edi_cl stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.64sec 0 300.01sec
edi_cl edi_cl totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 112.94sec 0 300.01sec
edi_cl edi_cl_primal_fire_elemental fire_blast 57984 25775741 134374 30.34 213177 426408 97.0 97.0 24.7% 0.0% 0.0% 0.0% 3.01sec 25775741 191.82sec
edi_cl edi_cl_greater_lightning_elemental lightning_blast 191726 7626321 179125 55.70 156534 313183 39.5 39.5 23.2% 0.0% 0.0% 0.0% 7.14sec 7626321 42.58sec
fs_fs fs_fs augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
fs_fs fs_fs earth_shock 8042 30676862 102254 3.10 1375047 3804251 15.5 15.5 24.9% 0.0% 0.0% 0.0% 18.62sec 30676862 300.01sec
fs_fs fs_fs elemental_blast 117014 18721854 62405 4.39 594157 1645174 22.0 22.0 24.6% 0.0% 0.0% 0.0% 13.81sec 18721854 300.01sec
fs_fs fs_fs elemental_blast_overload 120588 9875815 32919 2.78 499143 1382022 13.9 13.9 24.1% 0.0% 0.0% 0.0% 21.14sec 9875815 300.01sec
fs_fs fs_fs fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 105.73sec 0 300.01sec
fs_fs fs_fs flame_shock 188389 2771260 9237 2.24 104237 292468 11.2 11.2 75.9% 0.0% 0.0% 0.0% 27.76sec 42738891 300.01sec
fs_fs fs_fs flame_shock ticks -188389 39967631 133225 45.29 57403 218908 11.2 226.4 73.7% 0.0% 0.0% 0.0% 27.76sec 42738891 300.01sec
fs_fs fs_fs flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
fs_fs fs_fs food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
fs_fs fs_fs frost_shock 196840 36964311 123212 7.64 667060 1849201 38.2 38.2 25.4% 0.0% 0.0% 0.0% 7.57sec 36964311 300.01sec
fs_fs fs_fs icefury 210714 10600672 35335 1.93 756409 2095887 9.7 9.6 25.6% 0.0% 0.0% 0.0% 32.23sec 10600672 300.01sec
fs_fs fs_fs icefury_overload 219271 5717371 19058 1.24 635276 1762724 6.2 6.2 25.7% 0.0% 0.0% 0.0% 46.47sec 5717371 300.01sec
fs_fs fs_fs insidious_corruption ticks -243941 4382316 14608 9.60 73695 150258 5.1 48.0 23.0% 0.0% 0.0% 0.0% 60.45sec 4382316 300.01sec
fs_fs fs_fs lava_burst 51505 45115238 150381 11.59 0 778206 58.1 58.0 100.0% 0.0% 0.0% 0.0% 5.11sec 45115238 300.01sec
fs_fs fs_fs lava_burst_overload 77451 23158810 77195 7.37 0 628764 36.9 36.8 100.0% 0.0% 0.0% 0.0% 7.99sec 23158810 300.01sec
fs_fs fs_fs volcanic_inferno 205533 2555658 8519 8.66 46927 95752 43.3 43.3 24.7% 0.0% 0.0% 0.0% 6.28sec 2555658 300.01sec
fs_fs fs_fs lightning_bolt 188196 30106716 100354 17.81 237271 647858 89.1 89.1 24.5% 0.0% 0.0% 0.0% 3.27sec 30106716 300.01sec
fs_fs fs_fs lightning_bolt_overload 45284 25374674 84581 17.60 202609 552693 88.0 88.0 24.5% 0.0% 0.0% 0.0% 4.08sec 25374674 300.01sec
fs_fs fs_fs potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
fs_fs fs_fs spectral_owl 242570 13561730 45205 18.84 116064 236771 3.0 94.2 23.1% 0.0% 0.0% 0.0% 120.39sec 13561730 300.01sec
fs_fs fs_fs spectral_blast 246442 6288351 20961 7.48 135409 276235 37.5 37.4 23.2% 0.0% 0.0% 0.0% 7.02sec 6288351 300.01sec
fs_fs fs_fs stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.64sec 0 300.01sec
fs_fs fs_fs totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 112.90sec 0 300.01sec
fs_fs fs_fs_primal_fire_elemental fire_blast 57984 25791119 134315 30.34 213188 426361 97.1 97.1 24.6% 0.0% 0.0% 0.0% 3.00sec 25791119 192.02sec
fs_fs fs_fs_greater_lightning_elemental lightning_blast 191726 7638010 179285 55.71 156651 313321 39.6 39.6 23.3% 0.0% 0.0% 0.0% 7.15sec 7638010 42.60sec
li_lvb li_lvb augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
li_lvb li_lvb earth_shock 8042 30526541 101759 3.10 1374994 3806739 15.5 15.5 24.6% 0.0% 0.0% 0.0% 18.65sec 30526541 299.99sec
li_lvb li_lvb elemental_blast 117014 18708455 62364 4.39 594177 1644531 22.0 22.0 24.6% 0.0% 0.0% 0.0% 13.81sec 18708455 299.99sec
li_lvb li_lvb elemental_blast_overload 120588 9895474 32986 2.77 499082 1381784 13.9 13.9 24.3% 0.0% 0.0% 0.0% 21.13sec 9895474 299.99sec
li_lvb li_lvb fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 105.58sec 0 299.99sec
li_lvb li_lvb flame_shock 188389 2344740 7816 2.24 88063 247455 11.2 11.2 75.9% 0.0% 0.0% 0.0% 27.80sec 36150140 299.99sec
li_lvb li_lvb flame_shock ticks -188389 33805401 112685 45.28 48554 185269 11.2 226.4 73.7% 0.0% 0.0% 0.0% 27.80sec 36150140 299.99sec
li_lvb li_lvb flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
li_lvb li_lvb food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
li_lvb li_lvb frost_shock 196840 36959024 123201 7.64 667121 1849283 38.2 38.2 25.4% 0.0% 0.0% 0.0% 7.57sec 36959024 299.99sec
li_lvb li_lvb icefury 210714 10642746 35477 1.93 756597 2097176 9.7 9.6 25.9% 0.0% 0.0% 0.0% 32.23sec 10642746 299.99sec
li_lvb li_lvb icefury_overload 219271 5729751 19100 1.23 635914 1761122 6.2 6.2 26.1% 0.0% 0.0% 0.0% 47.42sec 5729751 299.99sec
li_lvb li_lvb insidious_corruption ticks -243941 4383270 14611 9.60 73706 150112 5.1 48.0 23.1% 0.0% 0.0% 0.0% 60.44sec 4383270 299.99sec
li_lvb li_lvb lava_burst 51505 48701757 162345 11.59 0 840735 58.1 57.9 100.0% 0.0% 0.0% 0.0% 5.11sec 48701757 299.99sec
li_lvb li_lvb lava_burst_overload 77451 25073702 83582 7.38 0 679280 37.0 36.9 100.0% 0.0% 0.0% 0.0% 7.96sec 25073702 299.99sec
li_lvb li_lvb volcanic_inferno 205533 2530400 8435 8.58 46930 95773 42.9 42.9 24.6% 0.0% 0.0% 0.0% 6.30sec 2530400 299.99sec
li_lvb li_lvb lightning_bolt 188196 30136430 100458 17.82 237170 648240 89.1 89.1 24.6% 0.0% 0.0% 0.0% 3.27sec 30136430 299.99sec
li_lvb li_lvb lightning_bolt_overload 45284 25279947 84269 17.55 202476 551760 87.8 87.8 24.5% 0.0% 0.0% 0.0% 4.10sec 25279947 299.99sec
li_lvb li_lvb potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
li_lvb li_lvb spectral_owl 242570 13562277 45209 18.84 116064 236771 3.0 94.2 23.1% 0.0% 0.0% 0.0% 120.39sec 13562277 299.99sec
li_lvb li_lvb spectral_blast 246442 6289543 20966 7.48 135409 276235 37.6 37.4 23.2% 0.0% 0.0% 0.0% 6.99sec 6289543 299.99sec
li_lvb li_lvb stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.64sec 0 299.99sec
li_lvb li_lvb totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 112.91sec 0 299.99sec
li_lvb li_lvb_primal_fire_elemental fire_blast 57984 25793022 134375 30.33 213208 426359 97.0 97.0 24.7% 0.0% 0.0% 0.0% 3.00sec 25793022 191.95sec
li_lvb li_lvb_greater_lightning_elemental lightning_blast 191726 7636882 179204 55.71 156560 313141 39.6 39.6 23.3% 0.0% 0.0% 0.0% 7.14sec 7636882 42.62sec
mb_lvs mb_lvs augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
mb_lvs mb_lvs earth_shock 8042 30550542 101833 3.10 1374620 3807669 15.5 15.5 24.6% 0.0% 0.0% 0.0% 18.63sec 30550542 300.01sec
mb_lvs mb_lvs elemental_blast 117014 18721950 62405 4.39 594213 1645211 22.0 22.0 24.6% 0.0% 0.0% 0.0% 13.81sec 18721950 300.01sec
mb_lvs mb_lvs elemental_blast_overload 120588 9897437 32991 2.78 499100 1382141 13.9 13.9 24.2% 0.0% 0.0% 0.0% 21.26sec 9897437 300.01sec
mb_lvs mb_lvs fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 105.76sec 0 300.01sec
mb_lvs mb_lvs flame_shock 188389 2347234 7824 2.24 88122 247495 11.2 11.2 76.0% 0.0% 0.0% 0.0% 27.79sec 36140856 300.01sec
mb_lvs mb_lvs flame_shock ticks -188389 33793622 112645 45.29 48561 185235 11.2 226.4 73.7% 0.0% 0.0% 0.0% 27.79sec 36140856 300.01sec
mb_lvs mb_lvs flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
mb_lvs mb_lvs food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
mb_lvs mb_lvs frost_shock 196840 36904109 123012 7.64 667182 1849179 38.2 38.2 25.2% 0.0% 0.0% 0.0% 7.57sec 36904109 300.01sec
mb_lvs mb_lvs icefury 210714 10616635 35388 1.93 756387 2096690 9.7 9.6 25.7% 0.0% 0.0% 0.0% 32.25sec 10616635 300.01sec
mb_lvs mb_lvs icefury_overload 219271 5684178 18947 1.23 635525 1761820 6.1 6.1 25.8% 0.0% 0.0% 0.0% 47.16sec 5684178 300.01sec
mb_lvs mb_lvs insidious_corruption ticks -243941 4384228 14614 9.60 73690 150154 5.1 48.0 23.1% 0.0% 0.0% 0.0% 60.45sec 4384228 300.01sec
mb_lvs mb_lvs lava_burst 51505 48162205 160538 11.57 0 832225 58.0 57.9 100.0% 0.0% 0.0% 0.0% 5.13sec 48162205 300.01sec
mb_lvs mb_lvs lava_burst_overload 77451 24165550 80550 7.37 0 655407 37.0 36.9 100.0% 0.0% 0.0% 0.0% 7.98sec 24165550 300.01sec
mb_lvs mb_lvs volcanic_inferno 205533 2540215 8467 8.61 46935 95747 43.1 43.1 24.7% 0.0% 0.0% 0.0% 6.27sec 2540215 300.01sec
mb_lvs mb_lvs lightning_bolt 188196 30078472 100260 17.83 237059 647862 89.1 89.1 24.4% 0.0% 0.0% 0.0% 3.27sec 30078472 300.01sec
mb_lvs mb_lvs lightning_bolt_overload 45284 25318687 84394 17.60 202028 552487 88.0 88.0 24.5% 0.0% 0.0% 0.0% 4.07sec 25318687 300.01sec
mb_lvs mb_lvs potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
mb_lvs mb_lvs spectral_owl 242570 13569459 45231 18.83 116064 236771 3.0 94.1 23.3% 0.0% 0.0% 0.0% 120.40sec 13569459 300.01sec
mb_lvs mb_lvs spectral_blast 246442 6270673 20902 7.47 135409 276235 37.5 37.3 23.1% 0.0% 0.0% 0.0% 6.98sec 6270673 300.01sec
mb_lvs mb_lvs stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.65sec 0 300.01sec
mb_lvs mb_lvs totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 112.86sec 0 300.01sec
mb_lvs mb_lvs_primal_fire_elemental fire_blast 57984 25764867 134321 30.33 213203 426417 97.0 97.0 24.6% 0.0% 0.0% 0.0% 3.01sec 25764867 191.82sec
mb_lvs mb_lvs_greater_lightning_elemental lightning_blast 191726 7616646 178853 55.71 156548 313171 39.5 39.5 23.0% 0.0% 0.0% 0.0% 7.14sec 7616646 42.59sec
tgt_eq tgt_eq augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq earth_shock 8042 30654019 102178 3.10 1375261 3807938 15.5 15.5 24.8% 0.0% 0.0% 0.0% 18.65sec 30654019 300.01sec
tgt_eq tgt_eq elemental_blast 117014 18770729 62568 4.39 594217 1645823 22.0 22.0 24.8% 0.0% 0.0% 0.0% 13.81sec 18770729 300.01sec
tgt_eq tgt_eq elemental_blast_overload 120588 9905214 33017 2.77 499200 1382779 13.9 13.8 24.5% 0.0% 0.0% 0.0% 21.29sec 9905214 300.01sec
tgt_eq tgt_eq fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 105.68sec 0 300.01sec
tgt_eq tgt_eq flame_shock 188389 2348132 7827 2.24 88165 247475 11.2 11.2 76.1% 0.0% 0.0% 0.0% 27.78sec 36179703 300.01sec
tgt_eq tgt_eq flame_shock ticks -188389 33831571 112772 45.29 48567 185261 11.2 226.4 73.8% 0.0% 0.0% 0.0% 27.78sec 36179703 300.01sec
tgt_eq tgt_eq flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq frost_shock 196840 36895684 122983 7.64 667143 1849312 38.2 38.2 25.2% 0.0% 0.0% 0.0% 7.57sec 36895684 300.01sec
tgt_eq tgt_eq icefury 210714 10625734 35418 1.93 756371 2095329 9.7 9.6 25.8% 0.0% 0.0% 0.0% 32.25sec 10625734 300.01sec
tgt_eq tgt_eq icefury_overload 219271 5701469 19005 1.23 635180 1761232 6.2 6.2 25.7% 0.0% 0.0% 0.0% 47.20sec 5701469 300.01sec
tgt_eq tgt_eq insidious_corruption ticks -243941 4382634 14609 9.60 73695 150157 5.1 48.0 23.1% 0.0% 0.0% 0.0% 60.44sec 4382634 300.01sec
tgt_eq tgt_eq lava_burst 51505 45106761 150353 11.59 0 778370 58.1 58.0 100.0% 0.0% 0.0% 0.0% 5.11sec 45106761 300.01sec
tgt_eq tgt_eq lava_burst_overload 77451 23159482 77197 7.37 0 628859 36.9 36.8 100.0% 0.0% 0.0% 0.0% 7.98sec 23159482 300.01sec
tgt_eq tgt_eq volcanic_inferno 205533 2548302 8494 8.64 46944 95797 43.2 43.2 24.6% 0.0% 0.0% 0.0% 6.34sec 2548302 300.01sec
tgt_eq tgt_eq lightning_bolt 188196 30097242 100322 17.82 237287 647194 89.1 89.1 24.5% 0.0% 0.0% 0.0% 3.28sec 30097242 300.01sec
tgt_eq tgt_eq lightning_bolt_overload 45284 25360172 84532 17.58 202584 552739 87.9 87.9 24.5% 0.0% 0.0% 0.0% 4.08sec 25360172 300.01sec
tgt_eq tgt_eq potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq spectral_owl 242570 13549244 45163 18.82 116064 236771 3.0 94.1 23.1% 0.0% 0.0% 0.0% 120.41sec 13549244 300.01sec
tgt_eq tgt_eq spectral_blast 246442 6270915 20903 7.46 135409 276235 37.4 37.3 23.3% 0.0% 0.0% 0.0% 7.05sec 6270915 300.01sec
tgt_eq tgt_eq stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.64sec 0 300.01sec
tgt_eq tgt_eq totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 112.90sec 0 300.01sec
tgt_eq tgt_eq_primal_fire_elemental fire_blast 57984 25830766 134475 30.33 213205 426482 97.1 97.1 24.8% 0.0% 0.0% 0.0% 3.00sec 25830766 192.09sec
tgt_eq tgt_eq_greater_lightning_elemental lightning_blast 191726 7627663 179053 55.70 156590 313210 39.5 39.5 23.2% 0.0% 0.0% 0.0% 7.15sec 7627663 42.60sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
1098534.5 1098534.5 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 11.29% 11.29% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:11.29%

Trigger Attempt Success

  • trigger_pct:99.29%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.82% 10.82% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.82%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.78% 10.78% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.78%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.28% 11.28% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.26% 10.26% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.26%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 9.35% 9.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:9.35%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.28% 11.28% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.82% 10.82% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.82%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.10% 8.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.02% 6.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.02%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 1098534.52
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 77476
Mean 300.00
Minimum 239.94
Maximum 360.05
Spread ( max - min ) 120.10
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 36.0078
5th Percentile 245.64
95th Percentile 354.35
( 95th Percentile - 5th Percentile ) 108.71
Mean Distribution
Standard Deviation 0.1294
95.00% Confidence Intervall ( 299.75 - 300.26 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 554
0.1% Error 55341
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1107
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 77476
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 77476
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 77476
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 77476
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 77476
Mean 1125315.29
Minimum 968771.60
Maximum 1333897.70
Spread ( max - min ) 365126.10
Range [ ( max - min ) / 2 * 100% ] 16.22%
Standard Deviation 43323.2709
5th Percentile 1056926.83
95th Percentile 1199547.20
( 95th Percentile - 5th Percentile ) 142620.36
Mean Distribution
Standard Deviation 155.6459
95.00% Confidence Intervall ( 1125010.23 - 1125620.35 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5694
0.1 Scale Factor Error with Delta=300 16022348
0.05 Scale Factor Error with Delta=300 64089390
0.01 Scale Factor Error with Delta=300 1602234748
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 77476
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 77476
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 77476
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 77476
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 275666862 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=113
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.